KEGG   Homo sapiens (human): 313
Entry
313               CDS       T01001                                 
Symbol
AOAH
Name
(RefSeq) acyloxyacyl hydrolase
  KO
K01065  acyloxyacyl hydrolase [EC:3.1.1.77]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    313 (AOAH)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.77  acyloxyacyl hydrolase
     313 (AOAH)
SSDB
Motif
Pfam: Lipase_GDSL SapB_2 Cu-binding_MopE Lipase_GDSL_2 Ribosomal_S10
Other DBs
NCBI-GeneID: 313
NCBI-ProteinID: NP_001628
OMIM: 102593
HGNC: 548
Ensembl: ENSG00000136250
Pharos: P28039(Tbio)
UniProt: P28039
Structure
Position
7:complement(36512941..36724494)
AA seq 575 aa
MQSPWKILTVAPLFLLLSLQSSASPANDDQSRPSLSNGHTCVGCVLVVSVIEQLAQVHNS
TVQASMERLCSYLPEKLFLKTTCYLVIDKFGSDIIKLLSADMNADVVCHTLEFCKQNTGQ
PLCHLYPLPKETWKFTLQKARQIVKKSPILKYSRSGSDICSLPVLAKICQKIKLAMEQSV
PFKDVDSDKYSVFPTLRGYHWRGRDCNDSDESVYPGRRPNNWDVHQDSNCNGIWGVDPKD
GVPYEKKFCEGSQPRGIILLGDSAGAHFHISPEWITASQMSLNSFINLPTALTNELDWPQ
LSGATGFLDSTVGIKEKSIYLRLWKRNHCNHRDYQNISRNGASSRNLKKFIESLSRNKVL
DYPAIVIYAMIGNDVCSGKSDPVPAMTTPEKLYSNVMQTLKHLNSHLPNGSHVILYGLPD
GTFLWDNLHNRYHPLGQLNKDMTYAQLYSFLNCLQVSPCHGWMSSNKTLRTLTSERAEQL
SNTLKKIAASEKFTNFNLFYMDFAFHEIIQEWQKRGGQPWQLIEPVDGFHPNEVALLLLA
DHFWKKVQLQWPQILGKENPFNPQIKQVFGDQGGH
NT seq 1728 nt   +upstreamnt  +downstreamnt
atgcagtccccctggaaaatccttacggtggcgcctctattcttgctcctgtctcttcag
tcctcggcctctccagccaacgatgaccagtccaggcccagcctctcgaatgggcacacc
tgtgtagggtgtgtgctggtggtgtctgtaatagaacagcttgctcaagttcacaactcg
acggtccaggcctcgatggagagactgtgcagctacctgcctgaaaaactgttcttgaaa
accacctgctatttagtcattgacaagtttggatcagacatcataaaactgcttagcgca
gatatgaatgctgatgtggtatgtcacactctggagttttgtaaacagaacactggccaa
ccattgtgtcatctctaccctcttcccaaggagacatggaaatttacactacagaaggca
agacaaattgtcaagaagtccccgattctgaaatattctagaagtggttctgacatttgt
tcactcccggttttggccaagatctgccagaaaattaaattagctatggaacagtctgtg
ccattcaaagatgtggattcagacaaatacagcgttttcccaacactgcggggctatcac
tggcgggggagagactgtaatgacagcgacgagtcagtgtacccaggtagaaggccgaac
aactgggatgtccatcaggattcaaactgtaatggcatttggggtgtcgatccaaaagat
ggagttccatatgagaagaaattctgtgaaggttcacagcccaggggaatcattttgctg
ggagactcagctggggctcattttcacatctctcctgaatggatcacagcgtcgcagatg
tctttgaactctttcatcaatctaccaacagcccttaccaacgagcttgactggccccaa
ctctctggtgctacaggatttctggactccactgttggaattaaagaaaaatctatttac
cttcgcttatggaaaagaaaccactgtaatcacagggactaccagaatatttcaagaaat
ggtgcatcttcccgaaacctgaagaaatttatagaaagcttgtctagaaacaaggtgttg
gactatcccgccatcgttatatatgccatgattggaaatgatgtctgcagtgggaagagt
gacccagtcccagccatgaccactcctgagaaactctactccaacgtcatgcagactctg
aagcatctaaattcccacctgcccaatggcagccatgttattttgtatggcttaccagat
ggaacctttctctgggataatttgcacaacagatatcatcctctcggccagctaaataaa
gacatgacctatgcgcagttgtactccttcctgaactgcctccaggtcagcccctgccac
ggctggatgtcttccaacaagacgttgcggactctcacttcagagagagcagagcaactc
tccaacacactgaaaaaaattgcagccagtgagaaatttacaaacttcaatcttttctac
atggattttgccttccatgaaatcatacaggagtggcagaagagaggcggacagccctgg
cagctcatcgagcccgtggatggattccaccccaacgaggtggctttgctgttgttggcg
gatcatttctggaaaaaggtgcagctccagtggccccaaatcctgggaaaggagaatccg
ttcaacccccagattaaacaggtgtttggagaccaaggcgggcactga

DBGET integrated database retrieval system