KEGG   Homo sapiens (human): 3131
Entry
3131              CDS       T01001                                 

Symbol
HLF
Name
(RefSeq) HLF transcription factor, PAR bZIP family member
  KO
K09057  hepatic leukemia factor
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3131 (HLF)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   bZIP/PAR
    3131 (HLF)
SSDB
Motif
Pfam: bZIP_2 bZIP_1 bZIP_Maf Cnn_1N
Other DBs
NCBI-GeneID: 3131
NCBI-ProteinID: NP_002117
OMIM: 142385
HGNC: 4977
Ensembl: ENSG00000108924
Vega: OTTHUMG00000177840
Pharos: Q16534(Tbio)
UniProt: Q16534
Position
17:55264960..55325187
AA seq 295 aa
MEKMSRPLPLNPTFIPPPYGVLRSLLENPLKLPLHHEDAFSKDKDKEKKLDDESNSPTVP
QSAFLGPTLWDKTLPYDGDTFQLEYMDLEEFLSENGIPPSPSQHDHSPHPPGLQPASSAA
PSVMDLSSRASAPLHPGIPSPNCMQSPIRPGQLLPANRNTPSPIDPDTIQVPVGYEPDPA
DLALSSIPGQEMFDPRKRKFSEEELKPQPMIKKARKVFIPDDLKDDKYWARRRKNNMAAK
RSRDARRLKENQIAIRASFLEKENSALRQEVADLRKELGKCKNILAKYEARHGPL
NT seq 888 nt   +upstreamnt  +downstreamnt
atggagaaaatgtcccgaccgctccccctgaatcccacctttatcccgcctccctacggc
gtgctcaggtccctgctggagaacccgctgaagctcccccttcaccacgaagacgcattt
agtaaagataaagacaaggaaaagaagctggatgatgagagtaacagcccgacggtcccc
cagtcggcattcctggggcctaccttatgggacaaaacccttccctatgacggagatact
ttccagttggaatacatggacctggaggagtttttgtcagaaaatggcattccccccagc
ccatctcagcatgaccacagccctcaccctcctgggctgcagccagcttcctcggctgcc
ccctcggtcatggacctcagcagccgggcctctgcaccccttcaccctggcatcccatct
ccgaactgtatgcagagccccatcagaccaggtcagctgttgccagcaaaccgcaataca
ccaagtcccattgatcctgacaccatccaggtcccagtgggttatgagccagacccagca
gatcttgccctttccagcatccctggccaggaaatgtttgaccctcgcaaacgcaagttc
tctgaggaagaactgaagccacagcccatgatcaagaaagctcgcaaagtcttcatccct
gatgacctgaaggatgacaagtactgggcaaggcgcagaaagaacaacatggcagccaag
cgctcccgcgacgcccggaggctgaaagagaaccagatcgccatccgggcctcgttcctg
gagaaggagaactcggccctccgccaggaggtggctgacttgaggaaggagctgggcaaa
tgcaagaacatacttgccaagtatgaggccaggcacgggcccctgtag

DBGET integrated database retrieval system