KEGG   Homo sapiens (human): 3135
Entry
3135              CDS       T01001                                 

Gene name
HLA-G, MHC-G
Definition
(RefSeq) major histocompatibility complex, class I, G
  KO
K06751  MHC class I antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04145  Phagosome
hsa04218  Cellular senescence
hsa04514  Cell adhesion molecules (CAMs)
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa04940  Type I diabetes mellitus
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05203  Viral carcinogenesis
hsa05320  Autoimmune thyroid disease
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06229  MHC presentation
  Element
N00184  KSHV MIR1/2 to antigen processing and presentation by MHC class I molecules
N00363  Antigen processing and presentation by MHC class I molecules
N00364  HPV E5 to antigen processing and presentation by MHC class I molecules
N00417  HCMV US6 to antigen processing and presentation by MHC class I molecules
N00418  HCMV US2/11 to antigen processing and presentation by MHC class I molecules
N00419  HCMV US3/10 to antigen processing and presentation by MHC class I molecules
N00461  HIV Nef to antigen processing and presentation by MHC class I molecules
N00479  EBV BNLF2a to antigen processing and presentation by MHC class I molecules
N00480  EBV BILF1 to antigen processing and presentation by MHC class I molecules
N00492  HTLV-1 p12 to antigen processing and presentation by MHC class I molecules
N00581  HSV ICP47 to antigen processing and presentation by MHC class I molecules
Disease
H00344  Leprosy
Drug target
Glatiramer acetate: D04318
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3135 (HLA-G)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3135 (HLA-G)
   04145 Phagosome
    3135 (HLA-G)
  09143 Cell growth and death
   04218 Cellular senescence
    3135 (HLA-G)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3135 (HLA-G)
   04612 Antigen processing and presentation
    3135 (HLA-G)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    3135 (HLA-G)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3135 (HLA-G)
   05330 Allograft rejection
    3135 (HLA-G)
   05332 Graft-versus-host disease
    3135 (HLA-G)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3135 (HLA-G)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3135 (HLA-G)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3135 (HLA-G)
   05170 Human immunodeficiency virus 1 infection
    3135 (HLA-G)
   05168 Herpes simplex virus 1 infection
    3135 (HLA-G)
   05163 Human cytomegalovirus infection
    3135 (HLA-G)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3135 (HLA-G)
   05169 Epstein-Barr virus infection
    3135 (HLA-G)
   05165 Human papillomavirus infection
    3135 (HLA-G)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3135 (HLA-G)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    3135 (HLA-G)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3135 (HLA-G)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Antigens
  3135 (HLA-G)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_3 C2-set_2 ig SNO
Other DBs
NCBI-GeneID: 3135
NCBI-ProteinID: NP_002118
OMIM: 142871
HGNC: 4964
Ensembl: ENSG00000204632
Vega: OTTHUMG00000031157
Pharos: P17693(Tbio)
UniProt: P17693 Q6DU14
Structure
PDB: 

Position
6p22.1
AA seq 338 aa
MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRF
DSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQ
WMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQR
RAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILT
WQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQ
SSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggtggtcatggcgccccgaaccctcttcctgctgctctcgggggccctgaccctgacc
gagacctgggcgggctcccactccatgaggtatttcagcgccgccgtgtcccggcccggc
cgcggggagccccgcttcatcgccatgggctacgtggacgacacgcagttcgtgcggttc
gacagcgactcggcgtgtccgaggatggagccgcgggcgccgtgggtggagcaggagggg
ccggagtattgggaagaggagacacggaacaccaaggcccacgcacagactgacagaatg
aacctgcagaccctgcgcggctactacaaccagagcgaggccagttctcacaccctccag
tggatgattggctgcgacctggggtccgacggacgcctcctccgcgggtatgaacagtat
gcctacgatggcaaggattacctcgccctgaacgaggacctgcgctcctggaccgcagcg
gacactgcggctcagatctccaagcgcaagtgtgaggcggccaatgtggctgaacaaagg
agagcctacctggagggcacgtgcgtggagtggctccacagatacctggagaacgggaag
gagatgctgcagcgcgcggacccccccaagacacacgtgacccaccaccctgtctttgac
tatgaggccaccctgaggtgctgggccctgggcttctaccctgcggagatcatactgacc
tggcagcgggatggggaggaccagacccaggacgtggagctcgtggagaccaggcctgca
ggggatggaaccttccagaagtgggcagctgtggtggtgccttctggagaggagcagaga
tacacgtgccatgtgcagcatgaggggctgccggagcccctcatgctgagatggaagcag
tcttccctgcccaccatccccatcatgggtatcgttgctggcctggttgtccttgcagct
gtagtcactggagctgcggtcgctgctgtgctgtggagaaagaagagctcagattga

DBGET integrated database retrieval system