KEGG   Homo sapiens (human): 3140
Entry
3140              CDS       T01001                                 

Gene name
MR1, HLALS
Definition
(RefSeq) major histocompatibility complex, class I-related
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_3 Ig_3 Ig_2 Insulin_TMD
Other DBs
NCBI-GeneID: 3140
NCBI-ProteinID: NP_001522
OMIM: 600764
HGNC: 4975
Ensembl: ENSG00000153029
Vega: OTTHUMG00000035175
Pharos: Q95460(Tbio)
UniProt: Q95460
Structure
PDB: 

Position
1q25.3
AA seq 341 aa
MGELMAFLLPLIIVLMVKHSDSRTHSLRYFRLGVSDPIHGVPEFISVGYVDSHPITTYDS
VTRQKEPRAPWMAENLAPDHWERYTQLLRGWQQMFKVELKRLQRHYNHSGSHTYQRMIGC
ELLEDGSTTGFLQYAYDGQDFLIFNKDTLSWLAVDNVAHTIKQAWEANQHELLYQKNWLE
EECIAWLKRFLEYGKDTLQRTEPPLVRVNRKETFPGVTALFCKAHGFYPPEIYMTWMKNG
EEIVQEIDYGDILPSGDGTYQAWASIELDPQSSNLYSCHVEHCGVHMVLQVPQESETIPL
VMKAVSGSIVLVIVLAGVGVLVWRRRPREQNGAIYLPTPDR
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgggggaactgatggcgttcctgttacctctcatcattgtgttaatggtgaagcacagc
gattcccggacgcactctctgagatattttcgcctgggcgtttcggatcccatccatggg
gtccctgaatttatttcggttgggtacgtggactcgcaccctatcaccacatatgacagt
gtcactcggcagaaggagccacgggccccatggatggcagagaacctcgcgcctgatcac
tgggagaggtacactcagctgctgaggggctggcagcagatgttcaaggtggaactgaag
cgcctacagaggcactacaatcactcagggtctcacacttaccagagaatgattggctgt
gagctgctggaggatggaagcaccacaggatttctgcagtatgcatatgacgggcaggat
ttcctgatcttcaataaagacaccctctcctggctggctgtagataatgtggctcacacc
atcaagcaggcatgggaggccaatcagcatgagttgctgtatcaaaagaattggctggaa
gaagaatgtattgcctggctaaagagattcctggagtatgggaaagacaccctacaaaga
acagagcccccactggtcagagtaaatcgcaaagaaacttttccaggggttacagctctc
ttctgcaaagctcatggcttttaccccccagaaatttacatgacatggatgaaaaacggg
gaagaaattgtccaagaaattgattatggagacattcttcccagtggggatggaacctat
caggcgtgggcatcaattgagcttgatcctcagagcagcaacctttactcctgtcatgtg
gagcactgcggtgtccacatggttcttcaggtcccccaggaatcagaaactatccctctt
gtgatgaaagctgtctctgggtccattgtccttgtcattgtgctggctggagttggtgtt
ctagtctggagaagaaggccccgagagcaaaatggagccatctaccttccaacaccagat
cgatga

DBGET integrated database retrieval system