KEGG   Homo sapiens (human): 3156Help
Entry
3156              CDS       T01001                                 

Gene name
HMGCR, LDLCQ3
Definition
(RefSeq) 3-hydroxy-3-methylglutaryl-CoA reductase
  KO
K00021  hydroxymethylglutaryl-CoA reductase (NADPH) [EC:1.1.1.34]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00900  Terpenoid backbone biosynthesis
hsa01100  Metabolic pathways
hsa04152  AMPK signaling pathway
hsa04976  Bile secretion
Module
hsa_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Drug target
Atorvastatin (DG00355): D00887 D02258 D07474 D11095
Cerivastatin (DG00356): D00889 D07661
Crilvastatin: D03601
Dalvastatin: D03643
Fluvastatin (DG00354): D00892 D07983
Lovastatin: D00359
Pitavastatin (DG01838): D01862 D10568 D11092
Pravastatin (DG00353): D00893 D08410
Rosuvastatin (DG00357): D01915 D08492
Simvastatin: D00434
Tenivastatin calcium: D03816
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    3156 (HMGCR)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    3156 (HMGCR)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    3156 (HMGCR)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.34  hydroxymethylglutaryl-CoA reductase (NADPH)
     3156 (HMGCR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG-CoA_red Sterol-sensing Patched
Motif
Other DBs
NCBI-GeneID: 3156
NCBI-ProteinID: NP_000850
OMIM: 142910
HGNC: 5006
Ensembl: ENSG00000113161
Vega: OTTHUMG00000102069
Pharos: P04035(Tclin)
UniProt: P04035 A0A024RAP2
Structure
PDB: 

Position
5q13.3
AA seq 888 aa AA seqDB search
MLSRLFRMHGLFVASHPWEVIVGTVTLTICMMSMNMFTGNNKICGWNYECPKFEEDVLSS
DIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTG
LNEALPFFLLLIDLSRASTLAKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIG
VGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGRPIWQLSHFAR
VLEEEENKPNPVTQRVKMIMSLGLVLVHAHSRWIADPSPQNSTADTSKVSLGLDENVSKR
IEPSVSLWQFYLSKMISMDIEQVITLSLALLLAVKYIFFEQTETESTLSLKNPITSPVVT
QKKVPDNCCRREPMLVRNNQKCDSVEEETGINRERKVEVIKPLVAETDTPNRATFVVGNS
SLLDTSSVLVTQEPEIELPREPRPNEECLQILGNAEKGAKFLSDAEIIQLVNAKHIPAYK
LETLMETHERGVSIRRQLLSKKLSEPSSLQYLPYRDYNYSLVMGACCENVIGYMPIPVGV
AGPLCLDEKEFQVPMATTEGCLVASTNRGCRAIGLGGGASSRVLADGMTRGPVVRLPRAC
DSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYIRFQSRSGDAMGMNMI
SKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVREV
LKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITL
MEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLAR
IVCGTVMAGELSLMAALAAGHLVKSHMIHNRSKINLQDLQGACTKKTA
NT seq 2667 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcaagactttttcgaatgcatggcctctttgtggcctcccatccctgggaagtc
atagtggggacagtgacactgaccatctgcatgatgtccatgaacatgtttactggtaac
aataagatctgtggttggaattatgaatgtccaaagtttgaagaggatgttttgagcagt
gacattataattctgacaataacacgatgcatagccatcctgtatatttacttccagttc
cagaatttacgtcaacttggatcaaaatatattttgggtattgctggccttttcacaatt
ttctcaagttttgtattcagtacagttgtcattcacttcttagacaaagaattgacaggc
ttgaatgaagctttgccctttttcctacttttgattgacctttccagagcaagcacatta
gcaaagtttgccctcagttccaactcacaggatgaagtaagggaaaatattgctcgtgga
atggcaattttaggtcctacgtttaccctcgatgctcttgttgaatgtcttgtgattgga
gttggtaccatgtcaggggtacgtcagcttgaaattatgtgctgctttggctgcatgtca
gttcttgccaactacttcgtgttcatgactttcttcccagcttgtgtgtccttggtatta
gagctttctcgggaaagccgcgagggtcgtccaatttggcagctcagccattttgcccga
gttttagaagaagaagaaaataagccgaatcctgtaactcagagggtcaagatgattatg
tctctaggcttggttcttgttcatgctcacagtcgctggatagctgatccttctcctcaa
aacagtacagcagatacttctaaggtttcattaggactggatgaaaatgtgtccaagaga
attgaaccaagtgtttccctctggcagttttatctctctaaaatgatcagcatggatatt
gaacaagttattaccctaagtttagctctccttctggctgtcaagtacatcttctttgaa
caaacagagacagaatctacactctcattaaaaaaccctatcacatctcctgtagtgaca
caaaagaaagtcccagacaattgttgtagacgtgaacctatgctggtcagaaataaccag
aaatgtgattcagtagaggaagagacagggataaaccgagaaagaaaagttgaggttata
aaacccttagtggctgaaacagataccccaaacagagctacatttgtggttggtaactcc
tccttactcgatacttcatcagtactggtgacacaggaacctgaaattgaacttcccagg
gaacctcggcctaatgaagaatgtctacagatacttgggaatgcagagaaaggtgcaaaa
ttccttagtgatgctgagatcatccagttagtcaatgctaagcatatcccagcctacaag
ttggaaactctgatggaaactcatgagcgtggtgtatctattcgccgacagttactttcc
aagaagctttcagaaccttcttctctccagtacctaccttacagggattataattactcc
ttggtgatgggagcttgttgtgagaatgttattggatatatgcccatccctgttggagtg
gcaggacccctttgcttagatgaaaaagaatttcaggttccaatggcaacaacagaaggt
tgtcttgtggccagcaccaatagaggctgcagagcaataggtcttggtggaggtgccagc
agccgagtccttgcagatgggatgactcgtggcccagttgtgcgtcttccacgtgcttgt
gactctgcagaagtgaaagcctggctcgaaacatctgaagggttcgcagtgataaaggag
gcatttgacagcactagcagatttgcacgtctacagaaacttcatacaagtatagctgga
cgcaacctttatatccgtttccagtccaggtcaggggatgccatggggatgaacatgatt
tcaaagggtacagagaaagcactttcaaaacttcacgagtatttccctgaaatgcagatt
ctagccgttagtggtaactattgtactgacaagaaacctgctgctataaattggatagag
ggaagaggaaaatctgttgtttgtgaagctgtcattccagccaaggttgtcagagaagta
ttaaagactaccacagaggctatgattgaggtcaacattaacaagaatttagtgggctct
gccatggctgggagcataggaggctacaacgcccatgcagcaaacattgtcaccgccatc
tacattgcctgtggacaggatgcagcacagaatgttggtagttcaaactgtattacttta
atggaagcaagtggtcccacaaatgaagatttatatatcagctgcaccatgccatctata
gagataggaacggtgggtggtgggaccaacctactacctcagcaagcctgtttgcagatg
ctaggtgttcaaggagcatgcaaagataatcctggggaaaatgcccggcagcttgcccga
attgtgtgtgggaccgtaatggctggggaattgtcacttatggcagcattggcagcagga
catcttgtcaaaagtcacatgattcacaacaggtcgaagatcaatttacaagacctccaa
ggagcttgcaccaagaagacagcctga

DBGET integrated database retrieval system