KEGG   Homo sapiens (human): 3158Help
Entry
3158              CDS       T01001                                 

Gene name
HMGCS2
Definition
(RefSeq) 3-hydroxy-3-methylglutaryl-CoA synthase 2
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00072  Synthesis and degradation of ketone bodies
hsa00280  Valine, leucine and isoleucine degradation
hsa00650  Butanoate metabolism
hsa00900  Terpenoid backbone biosynthesis
hsa01100  Metabolic pathways
hsa03320  PPAR signaling pathway
Module
hsa_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Disease
H01123  HMG-CoA synthase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    3158 (HMGCS2)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    3158 (HMGCS2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    3158 (HMGCS2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    3158 (HMGCS2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    3158 (HMGCS2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     3158 (HMGCS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N ACP_syn_III
Motif
Other DBs
NCBI-GeneID: 3158
NCBI-ProteinID: NP_005509
OMIM: 600234
HGNC: 5008
Ensembl: ENSG00000134240
Vega: OTTHUMG00000012101
Pharos: P54868(Tbio)
UniProt: P54868 A0A140VJL2
Structure
PDB: 

Position
1p12
AA seq 508 aa AA seqDB search
MQRLLTPVKRILQLTRAVQETSLTPARLLPVAHQRFSTASAVPLAKTDTWPKDVGILALE
VYFPAQYVDQTDLEKYNNVEAGKYTVGLGQTRMGFCSVQEDINSLCLTVVQRLMERIQLP
WDSVGRLEVGTETIIDKSKAVKTVLMELFQDSGNTDIEGIDTTNACYGGTASLFNAANWM
ESSSWDGRYAMVVCGDIAVYPSGNARPTGGAGAVAMLIGPKAPLALERGLRGTHMENVYD
FYKPNLASEYPIVDGKLSIQCYLRALDRCYTSYRKKIQNQWKQAGSDRPFTLDDLQYMIF
HTPFCKMVQKSLARLMFNDFLSASSDTQTSLYKGLEAFGGLKLEDTYTNKDLDKALLKAS
QDMFDKKTKASLYLSTHNGNMYTSSLYGCLASLLSHHSAQELAGSRIGAFSYGSGLAASF
FSFRVSQDAAPGSPLDKLVSSTSDLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPG
DTNSLFPGTWYLERVDEQHRRKYARRPV
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgtctgttgactccagtgaagcgcattctgcaactgacaagagcggtgcaggaa
acctccctcacacctgctcgcctgctcccagtagcccaccaaaggttttctacagcctct
gctgtccccctggccaaaacagatacttggccaaaggacgtgggcatcctggccctggag
gtctacttcccagcccaatatgtggaccaaactgacctggagaagtataacaatgtggaa
gcaggaaagtatacagtgggcttgggccagacccgtatgggcttctgctcagtccaagag
gacatcaactccctgtgcctgacggtggtgcaacggctgatggagcgcatacagctccca
tgggactctgtgggcaggctggaagtaggcactgagaccatcattgacaagtccaaagct
gtcaaaacagtgctcatggaactcttccaggattcaggcaatactgatattgagggcata
gataccaccaatgcctgctacggtggtactgcctccctcttcaatgctgccaactggatg
gagtccagttcctgggatggtcgttatgccatggtggtctgtggagacattgccgtctat
cccagtggtaatgctcgtcccacaggtggggccggagctgtggctatgctgattgggccc
aaggcccctctggccctggagcgagggctgaggggaacccatatggagaatgtgtatgac
ttctacaaaccaaatttggcctcggagtacccaatagtggatgggaagctttccatccag
tgctacttgcgggccttggatcgatgttacacatcataccgtaaaaaaatccagaatcag
tggaagcaagctggcagcgatcgacccttcacccttgacgatttacagtacatgatcttt
catacacccttttgcaagatggtccagaagtctctggctcgcctgatgttcaatgacttc
ctgtcagccagcagtgacacacaaaccagcttatataaggggctggaggctttcgggggg
ctaaagctggaagacacctacaccaacaaggacctggataaagcacttctaaaggcctct
caggacatgttcgacaagaaaaccaaggcttccctttacctctccactcacaatgggaac
atgtacacctcatccctgtacgggtgcctggcctcgcttctgtcccaccactctgcccaa
gaactggctggctccaggattggtgccttctcttatggctctggtttagcagcaagtttc
ttttcatttcgagtatcccaggatgctgctccaggctctcccctggacaagttggtgtcc
agcacatcagacctgccaaaacgcctagcctcccgaaagtgtgtgtctcctgaggagttc
acagaaataatgaaccaaagagagcaattctaccataaggtgaatttctccccacctggt
gacacaaacagccttttcccaggtacttggtacctggagcgagtggacgagcagcatcgc
cgaaagtatgcccggcgtcccgtctaa

DBGET integrated database retrieval system