KEGG   Homo sapiens (human): 3163Help
Entry
3163              CDS       T01001                                 

Gene name
HMOX2, HO-2
Definition
(RefSeq) heme oxygenase 2
  KO
K21418  heme oxygenase 2 [EC:1.14.14.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00860  Porphyrin and chlorophyll metabolism
hsa01100  Metabolic pathways
hsa04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    3163 (HMOX2)
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    3163 (HMOX2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.18  heme oxygenase (biliverdin-producing)
     3163 (HMOX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Heme_oxygenase SsgA
Motif
Other DBs
NCBI-GeneID: 3163
NCBI-ProteinID: NP_001120676
OMIM: 141251
HGNC: 5014
Ensembl: ENSG00000103415
Vega: OTTHUMG00000129473
Pharos: P30519(Tbio)
UniProt: P30519
Structure
PDB: 

Position
16p13.3
AA seq 316 aa AA seqDB search
MSAEVETSEGVDESEKKNSGALEKENQMRMADLSELLKEGTKEAHDRAENTQFVKDFLKG
NIKKELFKLATTALYFTYSALEEEMERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGEN
WEEQVQCPKAAQKYVERIHYIGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPST
GEGTQFYLFENVDNAQQFKQLYRARMNALDLNMKTKERIVEEANKAFEYNMQIFNELDQA
GSTLARETLEDGFPVHDGKGDMRKCPFYAAEQDKGALEGSSCPFRTAMAVLRKPSLQFIL
AAGVALAAGLLAWYYM
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcggaagtggaaacctcagagggggtagacgagtcagaaaaaaagaactctggg
gccctagaaaaggagaaccaaatgagaatggctgacctctcggagctcctgaaggaaggg
accaaggaagcacacgaccgggcagaaaacacccagtttgtcaaggacttcttgaaaggc
aacattaagaaggagctgtttaagctggccaccacggcactttacttcacatactcagcc
ctcgaggaggaaatggagcgcaacaaggaccatccagcctttgcccctttgtacttcccc
atggagctgcaccggaaggaggcgctgaccaaggacatggagtatttctttggtgaaaac
tgggaggagcaggtgcagtgccccaaggctgcccagaagtacgtggagcggatccactac
atagggcagaacgagccggagctactggtggcccatgcatacacccgctacatgggggat
ctctcggggggccaggtgctgaagaaggtggcccagcgagcactgaaactccccagcaca
ggggaagggacccagttctacctgtttgagaatgtggacaatgcccagcagttcaagcag
ctctaccgggccaggatgaacgccctggacctgaacatgaagaccaaagagaggatcgtg
gaggaggccaacaaggcttttgagtataacatgcagatattcaatgaactggaccaggcc
ggctccacactggccagagagaccttggaggatgggttccctgtacacgatgggaaagga
gacatgcgtaaatgccctttctacgctgctgaacaagacaaaggtgccctggagggcagc
agctgtcccttccgaacagctatggctgtgctgaggaagcccagcctccagttcatcctg
gccgctggtgtggccctagctgctggactcttggcctggtactacatgtga

DBGET integrated database retrieval system