KEGG   Homo sapiens (human): 3164Help
Entry
3164              CDS       T01001                                 

Gene name
NR4A1, GFRP1, HMR, N10, NAK-1, NGFIB, NP10, NUR77, TR3
Definition
(RefSeq) nuclear receptor subfamily 4 group A member 1
  KO
K04465  nuclear receptor subfamily 4 group A member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04925  Aldosterone synthesis and secretion
hsa04927  Cortisol synthesis and secretion
hsa04934  Cushing syndrome
Network
N00297  ACTH-cortisol signaling pathway
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00320  Mutation-activated PRKACA to ACTH-cortisol signaling pathway
N00321  Mutation-activated GNAS to ACTH-cortisol signaling pathway
N00322  Mutation-inactivated PRKAR1A to ACTH-cortisol signaling pathway
N00323  Mutation-inactivated PDE11A/PDE8B to ACTH-cortisol signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    3164 (NR4A1)
   04151 PI3K-Akt signaling pathway
    3164 (NR4A1)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    3164 (NR4A1)
   04927 Cortisol synthesis and secretion
    3164 (NR4A1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04934 Cushing syndrome
    3164 (NR4A1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3164 (NR4A1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    3164 (NR4A1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 nerve growth factor IB-like
    3164 (NR4A1)
Nuclear receptors [BR:hsa03310]
 4. Nerve growth factor IB like
  4A. Nerve growth factor IB like receptor
   3164 (NR4A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep zf-C4
Motif
Other DBs
NCBI-GeneID: 3164
NCBI-ProteinID: NP_002126
OMIM: 139139
HGNC: 7980
Ensembl: ENSG00000123358
Vega: OTTHUMG00000150393
Pharos: P22736(Tbio)
UniProt: P22736 A0A024R126
Structure
PDB: 

Position
12q13.13
AA seq 598 aa AA seqDB search
MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGY
TGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPV
DEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKA
SGPPQPPAFFSFSPPTGPSPSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHL
EGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAK
YICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDAS
PANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKW
AEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFG
DWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVA
AVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgccctgtatccaagcccaatatgggacaccagcaccgagtccgggaccccgtgaccac
ctggcaagcgaccccctgacccctgagttcatcaagcccaccatggacctggccagcccc
gaggcagcccccgctgcccccactgccctgcccagcttcagcaccttcatggacggctac
acaggagagtttgacaccttcctctaccagctgccaggaacagtccagccatgctcctca
gcctcctcctcggcctcctccacatcctcgtcctcagccacctcccctgcctctgcctcc
ttcaagttcgaggacttccaggtgtacggctgctaccccggccccctgagcggcccagtg
gatgaggccctgtcctccagtggctctgactactatggcagcccctgctcggccccgtcg
ccctccacgcccagcttccagccgccccagctctctccctgggatggctccttcggccac
ttctcgcccagccagacttacgaaggcctgcgggcatggacagagcagctgcccaaagcc
tctgggcccccacagcctccagccttcttttccttcagtcctcccaccggccccagcccc
agcctggcccagagccccctgaagttgttcccctcacaggccacccaccagctgggggag
ggagagagctattccatgcctacggccttcccaggtttggcacccacttctccacacctt
gagggctcggggatactggatacacccgtgacctcaaccaaggcccggagcggggcccca
ggtggaagtgaaggccgctgtgctgtgtgtggggacaacgcttcatgccagcattatggt
gtccgcacatgtgagggctgcaagggcttcttcaagcgcacagtgcagaaaaacgccaag
tacatctgcctggctaacaaggactgccctgtggacaagaggcggcgaaaccgctgccag
ttctgccgcttccagaagtgcctggcggtgggcatggtgaaggaagttgtccgaacagac
agcctgaaggggcggcggggccggctaccttcaaaacccaagcagcccccagatgcctcc
cctgccaatctcctcacttccctggtccgtgcacacctggactcagggcccagcactgcc
aaactggactactccaagttccaggagctggtgctgccccactttgggaaggaagatgct
ggggatgtacagcagttctacgacctgctctccggttctctggaggtcatccgcaagtgg
gcggagaagatccctggctttgctgagctgtcaccggctgaccaggacctgttgctggag
tcggccttcctggagctcttcatcctccgcctggcgtacaggtctaagccaggcgagggc
aagctcatcttctgctcaggcctggtgctacaccggctgcagtgtgcccgtggcttcggg
gactggattgacagtatcctggccttctcaaggtccctgcacagcttgcttgtcgatgtc
cctgccttcgcctgcctctctgcccttgtcctcatcaccgaccggcatgggctgcaggag
ccgcggcgggtggaggagctgcagaaccgcatcgccagctgcctgaaggagcacgtggca
gctgtggcgggcgagccccagccagccagctgcctgtcacgtctgttgggcaaactgccc
gagctgcggaccctgtgcacccagggcctgcagcgcatcttctacctcaagctggaggac
ttggtgccccctccacccatcattgacaagatcttcatggacacgctgcccttctga

DBGET integrated database retrieval system