KEGG   Homo sapiens (human): 3169Help
Entry
3169              CDS       T01001                                 

Gene name
FOXA1, HNF3A, TCF3A
Definition
(RefSeq) forkhead box A1
  KO
K09387  forkhead box protein A1, hepatocyte nuclear factor 3-alpha
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3169 (FOXA1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix tissue-specific regulators
    3169 (FOXA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Forkhead Forkhead_N HNF_C
Motif
Other DBs
NCBI-GeneID: 3169
NCBI-ProteinID: NP_004487
OMIM: 602294
HGNC: 5021
Ensembl: ENSG00000129514
Vega: OTTHUMG00000140253
Pharos: P55317(Tbio)
UniProt: P55317
Position
14q21.1
AA seq 472 aa AA seqDB search
MLGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTMNTMTTSGNMT
PASFNMSYANPGLGAGLSPGAVAGMPGGSAGAMNSMTAAGVTAMGTALSPSGMGAMGAQQ
AASMNGLGPYAAAMNPCMSPMAYAPSNLGRSRAGGGGDAKTFKRSYPHAKPPYSYISLIT
MAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVARSPDKPGK
GSYWTLHPDSGNMFENGCYLRRQKRFKCEKQPGAGGGGGSGSGGSGAKGGPESRKDPSGA
SNPSADSPLHRGVHGKTGQLEGAPAPGPAASPQTLDHSGATATGGASELKTPASSTAPPI
SSGPGALASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAY
EQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTS
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgttaggaactgtgaagatggaagggcatgaaaccagcgactggaacagctactacgca
gacacgcaggaggcctactcctccgtcccggtcagcaacatgaactcaggcctgggctcc
atgaactccatgaacacctacatgaccatgaacaccatgactacgagcggcaacatgacc
ccggcgtccttcaacatgtcctatgccaacccgggcctaggggccggcctgagtcccggc
gcagtagccggcatgccggggggctcggcgggcgccatgaacagcatgactgcggccggc
gtgacggccatgggtacggcgctgagcccgagcggcatgggcgccatgggtgcgcagcag
gcggcctccatgaatggcctgggcccctacgcggccgccatgaacccgtgcatgagcccc
atggcgtacgcgccgtccaacctgggccgcagccgcgcgggcggcggcggcgacgccaag
acgttcaagcgcagctacccgcacgccaagccgccctactcgtacatctcgctcatcacc
atggccatccagcaggcgcccagcaagatgctcacgctgagcgagatctaccagtggatc
atggacctcttcccctattaccggcagaaccagcagcgctggcagaactccatccgccac
tcgctgtccttcaatgactgcttcgtcaaggtggcacgctccccggacaagccgggcaag
ggctcctactggacgctgcacccggactccggcaacatgttcgagaacggctgctacttg
cgccgccagaagcgcttcaagtgcgagaagcagccgggggccggcggcgggggcgggagc
ggaagcgggggcagcggcgccaagggcggccctgagagccgcaaggacccctctggcgcc
tctaaccccagcgccgactcgcccctccatcggggtgtgcacgggaagaccggccagcta
gagggcgcgccggcccccgggcccgccgccagcccccagactctggaccacagtggggcg
acggcgacagggggcgcctcggagttgaagactccagcctcctcaactgcgccccccata
agctccgggcccggggcgctggcctctgtgcccgcctctcacccggcacacggcttggca
ccccacgagtcccagctgcacctgaaaggggacccccactactccttcaaccacccgttc
tccatcaacaacctcatgtcctcctcggagcagcagcataagctggacttcaaggcatac
gaacaggcactgcaatactcgccttacggctctacgttgcccgccagcctgcctctaggc
agcgcctcggtgaccaccaggagccccatcgagccctcagccctggagccggcgtactac
caaggtgtgtattccagacccgtcctaaacacttcctag

DBGET integrated database retrieval system