KEGG   Homo sapiens (human): 3172Help
Entry
3172              CDS       T01001                                 

Gene name
HNF4A, FRTS4, HNF4, HNF4a7, HNF4a8, HNF4a9, HNF4alpha, MODY, MODY1, NR2A1, NR2A21, TCF, TCF14
Definition
(RefSeq) hepatocyte nuclear factor 4 alpha
  KO
K07292  hepatocyte nuclear factor 4-alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04152  AMPK signaling pathway
hsa04950  Maturity onset diabetes of the young
Disease
H00410  Maturity onset diabetes of the young (MODY)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    3172 (HNF4A)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04950 Maturity onset diabetes of the young
    3172 (HNF4A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3172 (HNF4A)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    3172 (HNF4A)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    3172 (HNF4A)
Nuclear receptors [BR:hsa03310]
 2. Hepatocyte nuclear factor 4 like
  2A. Hepatocyte nuclear factor 4 receptor
   3172 (HNF4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep zf-C4
Motif
Other DBs
NCBI-GeneID: 3172
NCBI-ProteinID: NP_000448
OMIM: 600281
HGNC: 5024
Ensembl: ENSG00000101076
Vega: OTTHUMG00000032531
Pharos: P41235(Tbio)
UniProt: P41235 F1D8T1
Structure
PDB: 

Position
20q13.12
AA seq 474 aa AA seqDB search
MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNAPNSLGVSALC
AICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKC
FRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALLQAEVLSRQITSPVSGINGDIRAKK
IASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVFK
DVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAK
GLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKL
FGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEW
PRPRGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEVI
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgcgactctccaaaaccctcgtcgacatggacatggccgactacagtgctgcactggac
ccagcctacaccaccctggaatttgagaatgtgcaggtgttgacgatgggcaatgacacg
tccccatcagaaggcaccaacctcaacgcgcccaacagcctgggtgtcagcgccctgtgt
gccatctgcggggaccgggccacgggcaaacactacggtgcctcgagctgtgacggctgc
aagggcttcttccggaggagcgtgcggaagaaccacatgtactcctgcagatttagccgg
cagtgcgtggtggacaaagacaagaggaaccagtgccgctactgcaggctcaagaaatgc
ttccgggctggcatgaagaaggaagccgtccagaatgagcgggaccggatcagcactcga
aggtcaagctatgaggacagcagcctgccctccatcaatgcgctcctgcaggcggaggtc
ctgtcccgacagatcacctcccccgtctccgggatcaacggcgacattcgggcgaagaag
attgccagcatcgcagatgtgtgtgagtccatgaaggagcagctgctggttctcgttgag
tgggccaagtacatcccagctttctgcgagctccccctggacgaccaggtggccctgctc
agagcccatgctggcgagcacctgctgctcggagccaccaagagatccatggtgttcaag
gacgtgctgctcctaggcaatgactacattgtccctcggcactgcccggagctggcggag
atgagccgggtgtccatacgcatccttgacgagctggtgctgcccttccaggagctgcag
atcgatgacaatgagtatgcctacctcaaagccatcatcttctttgacccagatgccaag
gggctgagcgatccagggaagatcaagcggctgcgttcccaggtgcaggtgagcttggag
gactacatcaacgaccgccagtatgactcgcgtggccgctttggagagctgctgctgctg
ctgcccaccttgcagagcatcacctggcagatgatcgagcagatccagttcatcaagctc
ttcggcatggccaagattgacaacctgttgcaggagatgctgctgggagggtcccccagc
gatgcaccccatgcccaccaccccctgcaccctcacctgatgcaggaacatatgggaacc
aacgtcatcgttgccaacacaatgcccactcacctcagcaacggacagatgtgtgagtgg
ccccgacccaggggacaggcagccacccctgagaccccacagccctcaccgccaggtggc
tcagggtctgagccctataagctcctgccgggagccgtcgccacaatcgtcaagcccctc
tctgccatcccccagccgaccatcaccaagcaggaagttatctag

DBGET integrated database retrieval system