KEGG   Homo sapiens (human): 3174Help
Entry
3174              CDS       T01001                                 

Gene name
HNF4G, NR2A2, NR2A3
Definition
(RefSeq) hepatocyte nuclear factor 4 gamma
  KO
K08037  hepatocyte nuclear factor 4-gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    3174 (HNF4G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3174 (HNF4G)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    3174 (HNF4G)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    3174 (HNF4G)
Nuclear receptors [BR:hsa03310]
 2. Hepatocyte nuclear factor 4 like
  2A. Hepatocyte nuclear factor 4 receptor
   3174 (HNF4G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep zf-C4
Motif
Other DBs
NCBI-GeneID: 3174
NCBI-ProteinID: NP_001317490
OMIM: 605966
HGNC: 5026
Ensembl: ENSG00000164749
Vega: OTTHUMG00000149920
Pharos: Q14541(Tbio)
UniProt: Q14541
Structure
PDB: 

Position
8q21.13
AA seq 408 aa AA seqDB search
MNTTDNGVNCLCAICGDRATGKHYGASSCDGCKGFFRRSIRKSHVYSCRFSRQCVVDKDK
RNQCRYCRLRKCFRAGMKKEAVQNERDRISTRRSTFDGSNIPSINTLAQAEVRSRQISVS
SPGSSTDINVKKIASIGDVCESMKQQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHL
LLGATKRSMMYKDILLLGNNYVIHRNSCEVEISRVANRVLDELVRPFQEIQIDDNEYACL
KAIVFFDPDAKGLSDPVKIKNMRFQVQIGLEDYINDRQYDSRGRFGELLLLLPTLQSITW
QMIEQIQFVKLFGMVKIDNLLQEMLLGGASNDGSHLHHPMHPHLSQDPLTGQTILLGPMS
TLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQL
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaataccacagacaacggtgtcaactgtctgtgtgctatctgtggggacagagcaaca
ggaaaacactatggggcatccagctgtgatgggtgcaagggtttcttcagacgcagcatt
cgtaagagtcacgtttattcttgcaggttcagtcggcaatgtgttgttgacaaggacaaa
aggaatcaatgtagatattgtcgattaagaaagtgttttagagcgggaatgaaaaaagaa
gctgtacaaaatgaacgtgacagaataagcaccagaagaagcacatttgatggcagcaac
atcccctccattaacacactggcacaagctgaagttcggtctcgccagatctcagtctca
agccctgggtcaagcactgacataaacgttaagaaaattgcaagtattggtgatgtctgt
gaatctatgaaacagcagctcttagtcttggtggaatgggctaaatatattcctgccttc
tgtgaattaccattggatgatcaggtggcactgttgagagctcacgcaggggagcactta
ctgcttggagctacaaagagatccatgatgtataaagatattttgcttttgggaaacaac
tatgttattcaccgcaacagctgtgaagttgagattagccgtgtggccaatcgtgttcta
gatgagctggttagaccatttcaagaaatccagattgatgacaatgagtatgcttgttta
aaggcaattgtattttttgatccagatgcaaaagggctaagcgatccagtaaaaattaag
aacatgaggttccaagtgcagatcggtttggaggactacatcaatgatcggcagtatgac
tcccgggggaggtttggagagttgcttctgctcctgcccacactgcagagcatcacgtgg
caaatgattgagcaaatacagtttgttaaactttttgggatggttaaaattgacaatcta
cttcaggaaatgctattaggtggggcttccaatgatggcagtcatctccatcatccaatg
catccacatttgtctcaagacccattaactggacaaactatacttttaggtcccatgtca
acactggttcatgcagaccagatctcaactcctgaaaccccactcccttccccaccacaa
ggctctgggcaagaacagtacaaaatagctgcaaaccaagcatcagtcatttcacaccag
catctctccaaacaaaagcaattgtga

DBGET integrated database retrieval system