KEGG   Homo sapiens (human): 3176Help
Entry
3176              CDS       T01001                                 

Gene name
HNMT, HMT, HNMT-S1, HNMT-S2, MRT51
Definition
(RefSeq) histamine N-methyltransferase
  KO
K00546  histamine N-methyltransferase [EC:2.1.1.8]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00340  Histidine metabolism
Disease
H00768  Nonsyndromic autosomal recessive mental retardation (NS-ARMR)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    3176 (HNMT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.8  histamine N-methyltransferase
     3176 (HNMT)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   3176 (HNMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_12 Methyltransf_31 Methyltransf_16 EF-hand_8 Methyltransf_25
Motif
Other DBs
NCBI-GeneID: 3176
NCBI-ProteinID: NP_008826
OMIM: 605238
HGNC: 5028
Ensembl: ENSG00000150540
Vega: OTTHUMG00000131751
Pharos: P50135(Tchem)
UniProt: P50135
Structure
PDB: 

Position
2q22.1
AA seq 292 aa AA seqDB search
MASSMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIG
GGAGEIDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETS
SEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWD
KLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGNENGDLL
WDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggcatcttccatgaggagcttgttttctgaccacgggaaatatgttgaatctttccgg
aggtttctcaaccattccacggaacaccagtgcatgcaggaattcatggacaagaagctg
ccaggcataataggaaggattggagacacaaaatcagaaattaagattctaagcataggc
ggaggtgcaggtgaaattgatcttcaaattctctccaaagttcaggctcaatacccagga
gtttgtatcaacaatgaagttgttgagccaagtgctgaacaaattgccaaatacaaagag
cttgtagccaagacatcgaacctcgagaacgtaaagtttgcttggcataaggagacatca
tctgaataccaaagtagaatgttggagaaaaaggagcttcaaaagtgggactttattcat
atgattcaaatgctgtattatgtaaaagacatcccagctaccctgaaattcttccatagt
ctcttaggtaccaatgctaagatgctcattattgttgtgtcaggaagcagtggctgggac
aagctgtggaaaaagtacggatcacgctttccccaggatgacctctgccagtatatcaca
tcagatgacctcactcagatgctggacaacctagggcttaagtatgagtgctatgacctt
ttgtccaccatggatatatctgactgctttattgatggtaatgaaaatggagacctgctt
tgggattttttgactgaaacctgcaactttaatgccacagcaccacctgatctcagagca
gagcttgggaaagatctacaagagcctgaatttagtgctaagaaagaggggaaggttctt
tttaataatactctgagtttcatagtgattgaggcataa

DBGET integrated database retrieval system