KEGG   Homo sapiens (human): 317762
Entry
317762            CDS       T01001                                 
Symbol
CCDC85C
Name
(RefSeq) coiled-coil domain containing 85C
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: CCDC85 AMH_N ESSS
Other DBs
NCBI-GeneID: 317762
NCBI-ProteinID: NP_001138467
HGNC: 35459
Ensembl: ENSG00000205476
Pharos: A6NKD9(Tdark)
UniProt: A6NKD9
Position
14:complement(99500190..99604207)
AA seq 419 aa
MAKPAATAAAASEELSQVPDEELLRWSKEELARRLRRAEGEKVGLMLEHGGLMRDVNRRL
QQHLLEIRGLKDVNQRLQDDNQELRELCCFLDDDRQKGRKLAREWQRFGRHAAGAVWHEV
ARSQQKLRELEARQEALLRENLELKELVLLLDEERAALAATGAASGGGGGGGGAGSRSSI
DSQASLSGPLSGGAPGAGARDVGDGSSTSSAGSGGSPDHHHHVPPPLLPPGPHKAPDGKA
GATRRSLDDLSAPPHHRSIPNGLHDPSSTYIRQLESKVRLLEGDKLLAQQAGSGEFRTLR
KGFSPYHSESQLASLPPSYQDSLQNGPACPAPELPSPPSAGYSPAGQKPEAVVHAMKVLE
VHENLDRQLQDSCEEDLSEKEKAIVREMCNVVWRKLGDAASSKPSIRQHLSGNQFKGPL
NT seq 1260 nt   +upstreamnt  +downstreamnt
atggctaagcccgcggcgacggcggcggcggcgtcggaggagctgagccaggtgccggac
gaggagctgctgcgctggagcaaggaggagctggcgcggcggctgcggcgcgccgagggc
gagaaggtgggcctcatgctggagcacggcggcctgatgcgcgacgtgaaccggcggctg
cagcagcacctgctggagatccgcggcctcaaggacgtgaaccagcggctgcaggacgac
aaccaggagctgcgcgagctctgctgcttcctcgacgacgaccggcagaaggggcgcaag
ctggcgcgcgagtggcagcgcttcgggcgccacgcggccggcgccgtgtggcacgaggtg
gcccgctcgcagcagaagctgcgcgagctcgaggcgcgccaggaggccctgctgcgcgag
aacctggagctcaaggagctggtgctgctgctggacgaggagcgcgcggcactggcggcg
acgggggccgcaagcggtggcggcggcggcgggggcggcgccggctcccgcagctccatc
gacagccaggccagcctgagcgggccgctgtcgggtggcgcgcccggcgcgggggcccgc
gacgtgggcgacggcagcagtacgtccagcgcgggcagcggcggcagccccgaccaccac
caccacgtcccacccccgctgctgccccccgggccgcacaaggcccccgacggcaaggca
ggagccacacgtcggtccctggacgacttgtcggcgccgccgcaccaccgcagcatcccc
aacggcctgcacgatccctcatccacctacatcaggcaactggagagcaaagtgaggctg
ctggagggtgacaagctcctcgcacagcaggcaggctccggagagttccgcacgctgcgg
aaaggcttctcgccctaccactcggagtcccagcttgcgtccctgccgccctcctaccag
gactccctgcagaacggcccggcctgccccgcacctgagctgccctcgcccccctctgct
ggctacagccctgcaggacagaagcccgaggctgtcgtgcatgccatgaaggtcctggag
gtacacgagaatctggaccggcagctccaggacagctgtgaggaggacctgagtgagaag
gagaaggccatcgttcgcgagatgtgcaacgtggtctggagaaagctgggagatgcagcc
agctccaagccctccatacggcagcacctgtctgggaaccagttcaaggggcctttgtag

DBGET integrated database retrieval system