KEGG   Homo sapiens (human): 3178
Entry
3178              CDS       T01001                                 

Gene name
HNRNPA1, ALS19, ALS20, HNRPA1, HNRPA1L3, IBMPFD3, UP_1, hnRNP_A1, hnRNP-A1
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein A1
  KO
K12741  heterogeneous nuclear ribonucleoprotein A1/A3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05014  Amyotrophic lateral sclerosis
Disease
H00058  Amyotrophic lateral sclerosis (ALS)
H02031  Inclusion body myopathy with Paget disease of bone and frontotemporal dementia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    3178 (HNRNPA1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    3178 (HNRNPA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    3178 (HNRNPA1)
   03041 Spliceosome [BR:hsa03041]
    3178 (HNRNPA1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     3178 (HNRNPA1)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     3178 (HNRNPA1)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    3178 (HNRNPA1)
SSDB
Motif
Pfam: RRM_1 HnRNPA1 RRM_7 Nup35_RRM_2 PHM7_cyt
Other DBs
NCBI-GeneID: 3178
NCBI-ProteinID: NP_112420
OMIM: 164017
HGNC: 5031
Ensembl: ENSG00000135486
Vega: OTTHUMG00000169702
Pharos: P09651(Tchem)
UniProt: P09651 A0A024RAZ7
Structure
PDB: 

Position
12q13.13
AA seq 372 aa
MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFV
TYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHH
LRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKA
LSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGS
GDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGG
GSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGS
SSSSSYGSGRRF
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgtctaagtcagagtctcctaaagagcccgaacagctgaggaagctcttcattggaggg
ttgagctttgaaacaactgatgagagcctgaggagccattttgagcaatggggaacgctc
acggactgtgtggtaatgagagatccaaacaccaagcgctccaggggctttgggtttgtc
acatatgccactgtggaggaggtggatgcagctatgaatgcaaggccacacaaggtggat
ggaagagttgtggaaccaaagagagctgtctccagagaagattctcaaagaccaggtgcc
cacttaactgtgaaaaagatatttgttggtggcattaaagaagacactgaagaacatcac
ctaagagattattttgaacagtatggaaaaattgaagtgattgaaatcatgactgaccga
ggcagtggcaagaaaaggggctttgcctttgtaacctttgacgaccatgactccgtggat
aagattgtcattcagaaataccatactgtgaatggccacaactgtgaagttagaaaagcc
ctgtcaaagcaagagatggctagtgcttcatccagccaaagaggtcgaagtggttctgga
aactttggtggtggtcgtggaggtggtttcggtgggaatgacaacttcggtcgtggagga
aacttcagtggtcgtggtggctttggtggcagccgtggtggtggtggatatggtggcagt
ggggatggctataatggatttggtaatgatggtggttatggaggaggcggccctggttac
tctggaggaagcagaggctatggaagtggtggacagggttatggaaaccagggcagtggc
tatggcgggagtggcagctatgacagctataacaacggaggcggaggcggctttggcggt
ggtagtggaagcaattttggaggtggtggaagctacaatgattttgggaattacaacaat
cagtcttcaaattttggacccatgaagggaggaaattttggaggcagaagctctggcccc
tatggcggtggaggccaatactttgcaaaaccacgaaaccaaggtggctatggcggttcc
agcagcagcagtagctatggcagtggcagaagattttaa

DBGET integrated database retrieval system