KEGG   Homo sapiens (human): 3181Help
Entry
3181              CDS       T01001                                 

Gene name
HNRNPA2B1, HNRNPA2, HNRNPB1, HNRPA2, HNRPA2B1, HNRPB1, IBMPFD2, RNPA2, SNRPB1
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein A2/B1
  KO
K13158  heterogeneous nuclear ribonucleoprotein A2/B1
Organism
hsa  Homo sapiens (human)
Disease
H02031  Inclusion body myopathy with Paget disease of bone and frontotemporal dementia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    3181 (HNRNPA2B1)
   03041 Spliceosome [BR:hsa03041]
    3181 (HNRNPA2B1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3181 (HNRNPA2B1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Trans-acting binding proteins
     3181 (HNRNPA2B1)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   HnRNP proteins
    3181 (HNRNPA2B1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3181 (HNRNPA2B1)
  Exosomal proteins of colorectal cancer cells
   3181 (HNRNPA2B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_7
Motif
Other DBs
NCBI-GeneID: 3181
NCBI-ProteinID: NP_112533
OMIM: 600124
HGNC: 5033
Ensembl: ENSG00000122566
Vega: OTTHUMG00000023471
Pharos: P22626(Tbio)
UniProt: P22626
Structure
PDB: 

Position
7p15.2
AA seq 353 aa AA seqDB search
MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKR
SRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIK
EDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGH
NAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGF
GDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGGNYGSGNY
NDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGRSRY
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaactttagaaactgttcctttggagaggaaaaagagagaaaaggaacagttc
cgtaagctctttattggtggcttaagctttgaaaccacagaagaaagtttgaggaactac
tacgaacaatggggaaagcttacagactgtgtggtaatgagggatcctgcaagcaaaaga
tcaagaggatttggttttgtaactttttcatccatggctgaggttgatgctgccatggct
gcaagacctcattcaattgatgggagagtagttgagccaaaacgtgctgtagcaagagag
gaatctggaaaaccaggggctcatgtaactgtgaagaagctgtttgttggcggaattaaa
gaagatactgaggaacatcaccttagagattactttgaggaatatggaaaaattgatacc
attgagataattactgataggcagtctggaaagaaaagaggctttggctttgttactttt
gatgaccatgatcctgtggataaaatcgtattgcagaaataccataccatcaatggtcat
aatgcagaagtaagaaaggctttgtctagacaagaaatgcaggaagttcagagttctagg
agtggaagaggaggcaactttggctttggggattcacgtggtggcggtggaaatttcgga
ccaggaccaggaagtaactttagaggaggatctgatggatatggcagtggacgtggattt
ggggatggctataatgggtatggaggaggacctggaggtggcaattttggaggtagcccc
ggttatggaggaggaagaggaggatatggtggtggaggacctggatatggcaaccagggt
gggggctacggaggtggttatgacaactatggaggaggaaattatggaagtggaaattac
aatgattttggaaattataaccagcaaccttctaactacggtccaatgaagagtggaaac
tttggtggtagcaggaacatggggggaccatatggtggaggaaactatggtccaggaggc
agtggaggaagtgggggttatggtgggaggagccgatactga

DBGET integrated database retrieval system