KEGG   Homo sapiens (human): 3182
Entry
3182              CDS       T01001                                 

Gene name
HNRNPAB, ABBP1, HNRPAB
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein A/B
  KO
K13044  heterogeneous nuclear ribonucleoprotein A/B/D
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    3182 (HNRNPAB)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   HnRNP proteins
    3182 (HNRNPAB)
SSDB
Motif
Pfam: RRM_1 RRM_7 CBFNT Nup35_RRM_2 RRM_3 NID Peptidase_M16_C
Other DBs
NCBI-GeneID: 3182
NCBI-ProteinID: NP_112556
OMIM: 602688
HGNC: 5034
Ensembl: ENSG00000197451
Vega: OTTHUMG00000163452
Pharos: Q99729(Tbio)
UniProt: Q99729
Structure
PDB: 
3S7R

Position
5q35.3
AA seq 332 aa
MSEAGEEQPMETTGATENGHEAVPEGESPAGAGTGAAAGAGGATAAPPSGNQNGAEGDQI
NASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKD
AASVEKVLDQKEHRLDGRVIDPKKAMAMKKDPVKKIFVGGLNPEATEEKIREYFGEFGEI
EAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKFHTVSGSKCEIKVAQPKEVYQQQQY
GSGGRGNRNRGNRGSGGGGGGGGQSQSWNQGYGNYWNQGYGYQQGYGPGYGGYDYSPYGY
YGYGPGYDYSQGSTNYGKSQRRGGHQNNYKPY
NT seq 999 nt   +upstreamnt  +downstreamnt
atgtcggaagcgggcgaggagcagcccatggagacgacgggcgccaccgagaacggacat
gaggccgtccccgaaggcgagtcgccggccggggctggcacgggcgccgcggcgggggct
ggaggcgcgaccgcggcgcccccgagcgggaatcagaacggcgccgagggcgaccagatc
aacgccagcaagaacgaggaggacgcgggaaaaatgttcgttggtggcctgagctgggat
actagcaaaaaagatttaaaagactattttactaaatttggagaggtcgttgactgtaca
ataaaaatggatcccaacactggacggtcaagagggtttgggtttatcctgttcaaagat
gcagccagtgtggagaaggtcctagaccagaaggagcacaggctggatggccgtgtcatt
gaccctaaaaaggccatggctatgaagaaggacccggtgaagaaaatcttcgttgggggt
ctgaatcctgaagccactgaggaaaagatcagggagtactttggcgagtttggggagatt
gaggccattgaattgccaatggatccaaagttgaacaaaagacgaggttttgtgtttatc
acctttaaagaagaagaacccgtgaagaaggttctggagaaaaagttccatactgtcagt
ggaagcaagtgtgagatcaaggtggcccagcccaaagaagtctatcagcagcagcagtat
ggctctgggggccgtggaaaccgcaaccgagggaaccgaggcagcggaggtggtggtgga
ggtggaggtcagagtcagagttggaatcagggctacggcaactactggaaccagggctac
ggctaccagcagggctacgggcctggctatggcggctacgactactcgccctatggctat
tacggctacggccccggctacgactacagtcagggtagtacaaactacggcaagagccag
cgacgtggtggccatcagaataactacaagccatactga

DBGET integrated database retrieval system