KEGG   Homo sapiens (human): 3188Help
Entry
3188              CDS       T01001                                 

Gene name
HNRNPH2, FTP3, HNRPH', HNRPH2, MRXSB, NRPH2, hnRNPH'
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein H2
  KO
K12898  heterogeneous nuclear ribonucleoprotein F/H
Organism
hsa  Homo sapiens (human)
Disease
H00658  Syndromic X-linked mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    3188 (HNRNPH2)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   HnRNP proteins
    3188 (HNRNPH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 zf-RNPHF
Motif
Other DBs
NCBI-GeneID: 3188
NCBI-ProteinID: NP_001027565
OMIM: 300610
HGNC: 5042
Ensembl: ENSG00000126945
Vega: OTTHUMG00000022029
Pharos: P55795(Tbio)
UniProt: P55795 A0A384MDT2
Structure
PDB: 

Position
Xq22.1
AA seq 449 aa AA seqDB search
MMLSTEGREGFVVKVRGLPWSCSADEVMRFFSDCKIQNGTSGIRFIYTREGRPSGEAFVE
LESEEEVKLALKKDRETMGHRYVEVFKSNSVEMDWVLKHTGPNSPDTANDGFVRLRGLPF
GCSKEEIVQFFSGLEIVPNGMTLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRY
IEIFKSSRAEVRTHYDPPRKLMAMQRPGPYDRPGAGRGYNSIGRGAGFERMRRGAYGGGY
GGYDDYGGYNDGYGFGSDRFGRDLNYCFSGMSDHRYGDGGSSFQSTTGHCVHMRGLPYRA
TENDIYNFFSPLNPMRVHIEIGPDGRVTGEADVEFATHEDAVAAMAKDKANMQHRYVELF
LNSTAGTSGGAYDHSYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGY
GGGYGGQSSMSGYDQVLQENSSDYQSNLA
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgatgctgagcacggaaggcagggaggggttcgtggtgaaggtcaggggcctaccctgg
tcctgctcagccgatgaagtgatgcgcttcttctctgattgcaagatccaaaatggcaca
tcaggtattcgtttcatctacaccagagaaggcagaccaagtggtgaagcatttgttgaa
cttgaatctgaagaggaagtgaaattggctttgaagaaggacagagaaaccatgggacac
agatacgttgaagtattcaagtctaacagtgttgaaatggattgggtgttgaagcataca
ggtccgaatagccctgatactgccaacgatggcttcgtccggcttagaggactcccattt
ggctgtagcaaggaagagattgttcagttcttttcagggttggaaattgtgccaaatggg
atgacactgccagtggactttcaggggcgaagcacaggggaagcctttgtgcagtttgct
tcacaggagatagctgagaaggccttaaagaaacacaaggaaagaatagggcacaggtac
attgagatcttcaagagtagccgagctgaagttcgaacccactatgatccccctcgaaag
ctcatggctatgcagcggccaggtccctatgataggccgggggctggcagagggtataat
agcattggcagaggagctgggtttgaaaggatgaggcgtggtgcctatggtggagggtat
ggaggctatgatgactatggtggctataatgatggatatggctttgggtctgatagattt
ggaagagacctcaattactgtttttcaggaatgtctgatcatagatacggagatggtggg
tccagtttccagagcaccacagggcactgtgtacacatgagggggttaccttacagagcc
actgagaatgatatttataatttcttctcacctcttaatcccatgagagtacatattgaa
attggacccgatggcagagttaccggtgaggcagatgttgaatttgctactcatgaagat
gctgtggcagctatggcaaaagacaaagctaatatgcaacacagatatgtggagctcttc
ttaaattctactgcaggaacaagtgggggtgcttacgatcacagctatgtagaacttttt
ttgaattctacagcaggggcaagtggtggcgcttatggtagccaaatgatgggagggatg
ggcttatccaaccagtctagttatggaggtcctgctagccagcagctgagtggtggttat
ggaggtggttatggtggtcagagcagtatgagtggatatgaccaagttctgcaggaaaac
tccagtgactatcagtcaaaccttgcttag

DBGET integrated database retrieval system