KEGG   Homo sapiens (human): 3189Help
Entry
3189              CDS       T01001                                 

Gene name
HNRNPH3, 2H9, HNRPH3
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein H3
  KO
K12898  heterogeneous nuclear ribonucleoprotein F/H
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    3189 (HNRNPH3)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   HnRNP proteins
    3189 (HNRNPH3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1
Motif
Other DBs
NCBI-GeneID: 3189
NCBI-ProteinID: NP_001309363
OMIM: 602324
HGNC: 5043
Ensembl: ENSG00000096746
Vega: OTTHUMG00000018349
Pharos: P31942(Tbio)
UniProt: P31942 A0A024QZK8
Position
10q21.3
AA seq 346 aa AA seqDB search
MDWVMKHNGPNDASDGTVRLRGLPFGCSKEEIVQFFQGLEIVPNGITLTMDYQGRSTGEA
FVQFASKEIAENALGKHKERIGHRYIEIFRSSRSEIKGFYDPPRRLLGQRPGPYDRPIGG
RGGYYGAGRGSMYDRMRRGGDGYDGGYGGFDDYGGYNNYGYGNDGFDDRMRDGRGMGGHG
YGGAGDASSGFHGGHFVHMRGLPFRATENDIANFFSPLNPIRVHIDIGADGRATGEADVE
FVTHEDAVAAMSKDKNNMQHRYIELFLNSTPGGGSGMGGSGMGGYGRDGMDNQGGYGSVG
RMGMGNNYSGGYGTPDGLGGYGRGGGGSGGYYGQGGMSGGGWRGMY
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggattgggttatgaaacataatggtccaaatgacgctagtgatgggacagtacgactt
cgtggactaccatttggttgcagcaaagaggaaatagttcagttctttcaagggttggaa
atcgtgccaaatgggataacattgacgatggactaccaggggagaagcacaggggaggcc
ttcgtgcagtttgcttcaaaggagatagcagaaaatgctctggggaaacacaaggaaaga
atagggcacaggtatattgagatcttcagaagtagcaggagtgaaatcaaaggattttat
gatccaccaagaagattgctgggacagcgaccgggaccatatgatagaccaataggagga
agagggggttattatggagctgggcgtggaagtatgtatgacagaatgcgacgaggaggt
gatggatatgatggtggttatggaggttttgatgactatggtggctataataattacggc
tatgggaatgatggctttgatgacagaatgagagatggaagaggtatgggaggacatggc
tatggtggagctggtgatgcaagttcaggttttcatggtggtcatttcgtacatatgaga
gggttgccttttcgtgcaactgaaaatgacattgctaatttcttctcaccactaaatcca
atacgagttcatattgatattggagctgatggcagagccacaggagaagcagatgtagag
tttgtgacacatgaagatgcagtagctgccatgtctaaagataaaaataacatgcaacat
cgatatattgaactcttcttgaattctactcctggaggcggctctggcatgggaggttct
ggaatgggaggctacggaagagatggaatggataatcagggaggctatggatcagttgga
agaatgggaatggggaacaattacagtggaggatatggtactcctgatggtttgggtggt
tatggccgtggtggtggaggcagtggaggttactatgggcaaggcggcatgagtggaggt
ggatggcgtgggatgtactga

DBGET integrated database retrieval system