KEGG   Homo sapiens (human): 319
Entry
319               CDS       T01001                                 
Symbol
APOF, Apo-F, LTIP
Name
(RefSeq) apolipoprotein F
  KO
K25363  apolipoprotein F
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    319 (APOF)
SSDB
Motif
Pfam: Apolipo_F
Other DBs
NCBI-GeneID: 319
NCBI-ProteinID: NP_001629
OMIM: 107760
HGNC: 615
Ensembl: ENSG00000175336
Pharos: Q13790(Tbio)
UniProt: Q13790
Position
12:complement(56360568..56362857)
AA seq 326 aa
MTGLCGYSAPDMRGLRLIMIPVELLLCYLLLHPVDATSYGKQTNVLMHFPLSLESQTPSS
DPLSCQFLHPKSLPGFSHMAPLPKFLVSLALRNALEEAGCQADVWALQLQLYRQGGVNAT
QVLIQHLRGLQKGRSTERNVSVEALASALQLLAREQQSTGRVGRSLPTEDCENEKEQAVH
NVVQLLPGVGTFYNLGTALYYATQNCLGKARERGRDGAIDLGYDLLMTMAGMSGGPMGLA
ISAALKPALRSGVQQLIQYYQDQKDANISQPETTKEGLRAISDVSDLEETTTLASFISEV
VSSAPYWGWAIIKSYDLDPGAGSLEI
NT seq 981 nt   +upstreamnt  +downstreamnt
atgactggactgtgtgggtactctgctccagacatgcgtggcctcagactcatcatgata
ccagttgagctgctactttgctacctcctgctgcaccctgtggatgccacttcatatgga
aagcagacaaatgtcttgatgcactttcccttgtccttggaatcccagacaccctcctca
gaccccttgtcctgccaatttctgcacccaaagtcactgcctggtttcagccacatggcc
cctctacccaagttcttggtaagcctggctctaaggaatgccctggaggaagctggttgt
caggctgatgtttgggctctacagctacagctctaccgccagggtggtgtgaatgctaca
caggtcctcatccagcatcttcgagggctccagaaaggcagaagcacagagaggaacgtg
tcagtggaagccctggcctctgctctgcagctgttagccagggagcagcaaagcacagga
agggtcgggcgctccctcccgacagaggactgtgagaatgagaaggagcaagctgtgcac
aatgtagtccagctgctgccaggagtgggaaccttctacaacctgggcacagctttgtat
tatgctactcaaaactgcctgggcaaggccagggaacgaggccgagatggggccatagat
ctgggatatgaccttctgatgaccatggctgggatgtcaggggggcctatgggtctagcg
atcagtgctgcacttaaacctgcattaaggtctggggttcagcagttgatccagtattac
caagatcagaaagacgcaaacatctctcagccggagaccaccaaggagggtttgagggcc
atctcagatgtgagtgacttggaagaaacaactactctggcttctttcatatcagaagta
gtaagttcagctccctactgggggtgggccataatcaagagctatgacttagatcctggg
gctgggagtcttgagatataa

DBGET integrated database retrieval system