KEGG   Homo sapiens (human): 3190Help
Entry
3190              CDS       T01001                                 

Gene name
HNRNPK, AUKS, CSBP, HNRPK, TUNP
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein K
  KO
K12886  heterogeneous nuclear ribonucleoprotein K
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05168  Herpes simplex infection
hsa05203  Viral carcinogenesis
hsa05206  MicroRNAs in cancer
Network
N00270  HCV Core to host-cell-protein inhibition
Disease
H01930  Au-Kline syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    3190 (HNRNPK)
 09160 Human Diseases
  09161 Cancers: Overview
   05206 MicroRNAs in cancer
    3190 (HNRNPK)
   05203 Viral carcinogenesis
    3190 (HNRNPK)
  09172 Infectious diseases: Viral
   05168 Herpes simplex infection
    3190 (HNRNPK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    3190 (HNRNPK)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    3190 (HNRNPK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: KH_1 ROKNT KH_2 KH_4 KH_5 DJ-1_PfpI
Motif
Other DBs
NCBI-GeneID: 3190
NCBI-ProteinID: NP_001305117
OMIM: 600712
HGNC: 5044
Ensembl: ENSG00000165119
Vega: OTTHUMG00000020107
Pharos: P61978(Tbio)
UniProt: P61978
Structure
PDB: 

Position
9q21.32
AA seq 463 aa AA seqDB search
METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGK
GGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEGLQLPSPTAT
SQLPLESDAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKL
FQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETYDYGGFT
MMFDDRRGRPVGFPMRGRGGFDRMPPGRGGRPMPPSRRDYDDMSPRRGPPPPPPGRGGRG
GSRARNLPLPPPPPPRGGDLMAYDRRGRPGDRYDGMVGFSADETWDSAIDTWSPSEWQMA
YEPQGGSGYDYSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGAS
IKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggaaactgaacagccagaagaaaccttccctaacactgaaaccaatggtgaatttggt
aaacgccctgcagaagatatggaagaggaacaagcatttaaaagatctagaaacactgat
gagatggttgaattacgcattctgcttcagagcaagaatgctggggcagtgattggaaaa
ggaggcaagaatattaaggctctccgtacagactacaatgccagtgtttcagtcccagac
agcagtggccccgagcgcatattgagtatcagtgctgatattgaaacaattggagaaatt
ctgaagaaaatcatccctaccttggaagagggcctgcagttgccatcacccactgcaacc
agccagctcccgctcgaatctgatgctgtggaatgcttaaattaccaacactataaagga
agtgactttgactgcgagttgaggctgttgattcatcagagtctagcaggaggaattatt
ggggtcaaaggtgctaaaatcaaagaacttcgagagaacactcaaaccaccatcaagctt
ttccaggaatgctgtcctcattccactgacagagttgttcttattggaggaaaacccgat
agggttgtagagtgcataaagatcatccttgatcttatatctgagtctcccatcaaagga
cgtgcacagccttatgatcccaatttttacgatgaaacctatgattatggtggttttaca
atgatgtttgatgaccgtcgcggacgcccagtgggatttcccatgcggggaagaggtggt
tttgacagaatgcctcctggtcggggtgggcgtcccatgcctccatctagaagagattat
gatgatatgagccctcgtcgaggaccacctccccctcctcccggacgaggcggccggggt
ggtagcagagctcggaatcttcctcttcctccaccaccaccacctagagggggagacctc
atggcctatgacagaagagggagacctggagaccgttacgacggcatggttggtttcagt
gctgatgaaacttgggactctgcaatagatacatggagcccatcagaatggcagatggct
tatgaaccacagggtggctccggatatgattattcctatgcagggggtcgtggctcatat
ggtgatcttggtggacctattattactacacaagtaactattcccaaagatttggctgga
tctattattggcaaaggtggtcagcggattaaacaaatccgtcatgagtcgggagcttcg
atcaaaattgatgagcctttagaaggatccgaagatcggatcattaccattacaggaaca
caggaccagatacagaatgcacagtatttgctgcagaacagtgtgaagcagtattctgga
aagtttttctaa

DBGET integrated database retrieval system