KEGG   Homo sapiens (human): 319101
Entry
319101            CDS       T01001                                 

Gene name
KRT73, CK-73, IRT6IRS3, K6IRS3, K73, KRT6IRS3
Definition
(RefSeq) keratin 73
  KO
K07605  type II keratin, basic
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    319101 (KRT73)
   04147 Exosome [BR:hsa04147]
    319101 (KRT73)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     319101 (KRT73)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   319101 (KRT73)
  Exosomal proteins of other body fluids (saliva and urine)
   319101 (KRT73)
  Exosomal proteins of colorectal cancer cells
   319101 (KRT73)
  Exosomal proteins of bladder cancer cells
   319101 (KRT73)
SSDB
Motif
Pfam: Filament Keratin_2_head CENP-F_leu_zip Taxilin Spc7 TPR_MLP1_2 ADIP Baculo_PEP_C DUF2315 Bap31_Bap29_C DUF1664 Alanine_zipper Golgin_A5
Other DBs
NCBI-GeneID: 319101
NCBI-ProteinID: NP_778238
OMIM: 608247
HGNC: 28928
Ensembl: ENSG00000186049
Vega: OTTHUMG00000169746
Pharos: Q86Y46(Tdark)
UniProt: Q86Y46
Position
12q13.13
AA seq 540 aa
MSRQFTYKSGAAAKGGFSGCSAVLSGGSSSSYRAGGKGLSGGFSSRSLYSLGGARSISFN
VASGSGWAGGYGFGRGRASGFAGSMFGSVALGSVCPSLCPPGGIHQVTINKSLLAPLNVE
LDPEIQKVRAQEREQIKVLNNKFASFIDKVRFLEQQNQVLETKWELLQQLDLNNCKNNLE
PILEGYISNLRKQLETLSGDRVRLDSELRSVREVVEDYKKRYEEEINKRTTAENEFVVLK
KDVDAAYTSKVELQAKVDALDGEIKFFKCLYEGETAQIQSHISDTSIILSMDNNRNLDLD
SIIAEVRAQYEEIARKSKAEAEALYQTKFQELQLAAGRHGDDLKHTKNEISELTRLIQRL
RSEIESVKKQCANLETAIADAEQRGDCALKDARAKLDELEGALQQAKEELARMLREYQEL
LSVKLSLDIEIATYRKLLEGEECRMSGEYTNSVSISVINSSMAGMAGTGAGFGFSNAGTY
GYWPSSVSGGYSMLPGGCVTGSGNCSPRGEARTRLGSASEFRDSQGKTLALSSPTKKTMR
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgagccgccaattcacctacaagtcgggagctgctgccaaggggggcttcagcggctgc
tccgctgtgctctcagggggcagctcatcctcctaccgagcagggggcaaagggctcagt
ggaggcttcagcagtcggagcctttacagcctggggggtgcccggagcatctctttcaat
gtggccagtggcagtgggtgggcaggaggctatggatttggccggggccgggccagtggc
tttgctggcagcatgtttggcagtgtggccttggggtccgtgtgtccgtcgttgtgcccg
cccgggggtatccatcaggtcaccatcaacaagagcctcctggcacccctgaacgtggag
ctggaccctgaaatccagaaagtgcgtgcccaggagcgggagcagatcaaggtgctgaac
aacaagttcgcctccttcattgacaaggtgcggttcctggagcagcagaaccaggtgctg
gagaccaagtgggagctgctacagcagctggacctgaacaactgcaagaataacctggag
cccatccttgagggctacatcagcaacctgcggaagcagctggagacgctgtctggggac
agggtgaggctggactcggagctgaggagcgtgcgcgaagtggtggaggactacaagaag
aggtatgaagaagaaataaacaagcgcacaactgctgagaatgaatttgtggtgcttaag
aaggacgtggacgcagcttacacgagcaaagtggagctgcaggccaaggtggatgccctg
gatggagaaatcaagttcttcaagtgtctgtacgagggggagactgctcagatccagtcc
cacatcagcgacacgtccatcatcctgtccatggacaacaaccggaacctggacctggac
agcatcattgctgaggtccgtgcccagtatgaggagatcgcccggaagagcaaggccgag
gccgaggccctgtaccagaccaagttccaggagctgcagctagcagccggccggcatggg
gatgacctgaaacacaccaaaaatgagatctcagagctgacccgtctcatccaaagactg
cgctcggagattgagagtgtgaagaagcagtgtgccaacctggagacggccatcgctgac
gccgagcagcggggggactgtgccctcaaggatgccagggccaagctggatgagctggag
ggcgccctgcagcaggccaaggaggagctggcacggatgctgcgcgagtaccaagagctt
ttgagcgtgaagctgtccctggatattgagatcgccacctaccgcaagctgctggagggc
gaggagtgcaggatgtccggagaatataccaactccgtgagcatttcggtcatcaacagc
tccatggccgggatggcaggcacaggggctggctttggattcagcaatgctggcacctac
ggctactggcccagctctgtcagcgggggctacagcatgctgcctgggggctgtgtcact
ggcagtgggaactgtagcccccgtggggaagccaggaccaggctggggagtgcaagtgaa
ttcagggactcccagggaaagaccttagctctaagctcacccaccaaaaaaaccatgaga
taa

DBGET integrated database retrieval system