KEGG   Homo sapiens (human): 3198Help
Entry
3198              CDS       T01001                                 

Gene name
HOXA1, BSAS, HOX1, HOX1F
Definition
(RefSeq) homeobox A1
  KO
K09301  homeobox protein HoxA/B/D1
Organism
hsa  Homo sapiens (human)
Disease
H00727  Athabascan brainstem dysgenesis syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3198 (HOXA1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, Antp
    3198 (HOXA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain
Motif
Other DBs
NCBI-GeneID: 3198
NCBI-ProteinID: NP_005513
OMIM: 142955
HGNC: 5099
Ensembl: ENSG00000105991
Vega: OTTHUMG00000023207
Pharos: P49639(Tbio)
UniProt: P49639
Position
7p15.2
AA seq 335 aa AA seqDB search
MDNARMNSFLEYPILSSGDSGTCSARAYPSDHRITTFQSCAVSANSCGGDDRFLVGRGVQ
IGSPHHHHHHHHHHPQPATYQTSGNLGVSYSHSSCGPSYGSQNFSAPYSPYALNQEADVS
GGYPQCAPAVYSGNLSSPMVQHHHHHQGYAGGAVGSPQYIHHSYGQEHQSLALATYNNSL
SPLHASHQEACRSPASETSSPAQTFDWMKVKRNPPKTGKVGEYGYLGQPNAVRTNFTTKQ
LTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPISPATP
PGNDEKAEESSEKSSSSPCVPSPGSSTSDTLTTSH
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggacaatgcaagaatgaactccttcctggaataccccatacttagcagtggcgactcg
gggacctgctcagcccgagcctacccctcggaccataggattacaactttccagtcgtgc
gcggtcagcgccaacagttgcggcggcgacgaccgcttcctagtgggcaggggggtgcag
atcggttcgccccaccaccaccaccaccaccaccatcaccacccccagccggctacctac
cagacttccgggaacctgggggtgtcctactcccactcaagttgtggtccaagctatggc
tcacagaacttcagtgcgccttacagcccctacgcgttaaatcaggaagcagacgtaagt
ggtgggtacccccagtgcgctcccgctgtttactctggaaatctctcatctcccatggtc
cagcatcaccaccaccaccagggttatgctgggggcgcggtgggctcgcctcaatacatt
caccactcatatggacaggagcaccagagcctggccctggctacgtataataactccttg
tcccctctccacgccagccaccaagaagcctgtcgctcccccgcatcggagacatcttct
ccagcgcagacttttgactggatgaaagtcaaaagaaaccctcccaaaacagggaaagtt
ggagagtacggctacctgggtcaacccaacgcggtgcgcaccaacttcactaccaagcag
ctcacggaactggagaaggagttccacttcaacaagtacctgacgcgcgcccgcagggtg
gagatcgctgcatccctgcagctcaacgagacccaagtgaagatctggttccagaaccgc
cgaatgaagcaaaagaaacgtgagaaggagggtctcttgcccatctctccggccaccccg
ccaggaaacgacgagaaggccgaggaatcctcagagaagtccagctcttcgccctgcgtt
ccttccccggggtcttctacctcagacactctgactacctcccactga

DBGET integrated database retrieval system