KEGG   Homo sapiens (human): 3201
Entry
3201              CDS       T01001                                 

Gene name
HOXA4, HOX1, HOX1D
Definition
(RefSeq) homeobox A4
  KO
K09304  homeobox protein HoxA/B/C/D4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3201 (HOXA4)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Antp
    3201 (HOXA4)
SSDB
Motif
Pfam: Homeodomain DUF2209 Homeobox_KN Terminase_5
Other DBs
NCBI-GeneID: 3201
NCBI-ProteinID: NP_002132
OMIM: 142953
HGNC: 5105
Ensembl: ENSG00000197576
Vega: OTTHUMG00000023213
Pharos: Q00056(Tbio)
UniProt: Q00056
Position
7p15.2
AA seq 320 aa
MTMSSFLINSNYIEPKFPPFEEYAQHSGSGGADGGPGGGPGYQQPPAPPTQHLPLQQPQL
PHAGGGREPTASYYAPRTAREPAYPAAALYPAHGAADTAYPYGYRGGASPGRPPQPEQPP
AQAKGPAHGLHASHVLQPQLPPPLQPRAVPPAAPRRCEAAPATPGVPAGGSAPACPLLLA
DKSPLGLKGKEPVVYPWMKKIHVSAVNPSYNGGEPKRSRTAYTRQQVLELEKEFHFNRYL
TRRRRIEIAHTLCLSERQVKIWFQNRRMKWKKDHKLPNTKMRSSNSASASAGPPGKAQTQ
SPHLHPHPHPSTSTPVPSSI
NT seq 963 nt   +upstreamnt  +downstreamnt
atgaccatgagctcgtttttgataaactccaactacatcgagcccaagttccctcccttc
gaggagtacgcgcagcacagcggctcgggcggcgcagacggcggcccgggcgggggcccc
ggctaccagcagcccccagcgcccccgacccagcacctgccgctgcagcagccccagctc
cctcacgcgggcggcggccgagagcccactgcctcctactacgcgccgcggaccgcccgc
gagcccgcctaccctgctgccgcgctgtaccccgcgcatggggccgcggacaccgcctac
ccctatggctaccgcggcggcgccagccccgggcggccgccccagcccgagcagcccccg
gcgcaagccaagggcccagcgcacggcctgcatgcgagccacgtcctgcagccccagctg
ccgccgcccctgcagcctcgcgccgtgcccccagcggccccgcggcgctgcgaggcggcc
cccgccaccccaggcgtcccggcagggggcagcgcccccgcgtgcccgctgctcttggcc
gacaagagcccgctgggcctgaagggcaaggagcccgtggtgtacccctggatgaagaag
atccatgtcagcgccgttaaccccagttataacggaggggagcctaagcgctctcgaacc
gcctacacccggcagcaggtcttggagctggagaaggagttccacttcaatcgatacctg
acccggcggcgccgcatcgagatcgcccacacgctctgtttgtctgagcgccaggtcaag
atctggtttcagaaccggaggatgaagtggaagaaagaccacaaactgcccaacaccaag
atgcgatcctccaattcggcctcggcctctgccggcccaccagggaaagcacaaactcag
agcccacacctccatccccacccccacccgagcacctccacacccgttccctcctccata
taa

DBGET integrated database retrieval system