KEGG   Homo sapiens (human): 3204Help
Entry
3204              CDS       T01001                                 

Gene name
HOXA7, ANTP, HOX1, HOX1.1, HOX1A
Definition
(RefSeq) homeobox A7
  KO
K09307  homeobox protein HoxA/B7
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3204 (HOXA7)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Antp
    3204 (HOXA7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Ribosomal_60s DUF2209
Motif
Other DBs
NCBI-GeneID: 3204
NCBI-ProteinID: NP_008827
OMIM: 142950
HGNC: 5108
Ensembl: ENSG00000122592
Vega: OTTHUMG00000023217
Pharos: P31268(Tbio)
UniProt: P31268
Position
7p15.2
AA seq 230 aa AA seqDB search
MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGAGAGAFASTVPGLYNVNSP
LYQSPFASGYGLGADAYGNLPCASYDQNIPGLCSDLAKGACDKTDEGALHGAAEANFRIY
PWMRSSGPDRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQN
RRMKWKKEHKDEGPTAAAAPEGAVPSAAATAAADKADEEDDDEEEEDEEE
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgagttcttcgtattatgtgaacgcgctttttagcaaatatacggcgggggcttctctg
ttccaaaatgccgagccgacttcttgctcctttgctcccaactcacagagaagcggctac
ggggcgggcgccggcgccttcgcctcgaccgttccgggcttatacaatgtcaacagcccc
ctttatcagagcccctttgcgtccggctacggcctgggcgccgacgcctacggcaacctg
ccctgcgcctcctacgaccaaaacatccccgggctctgcagtgacctcgccaaaggcgcc
tgcgacaagacggacgagggcgcgctgcatggcgcggctgaggccaatttccgcatctac
ccctggatgcggtcttcaggacctgacaggaagcggggccgccagacctacacgcgctac
cagacgctggagctggagaaggagttccacttcaaccgctacctgacgcggcgccgccgc
attgaaatcgcccacgcgctctgcctcaccgagcgccagattaagatctggttccagaac
cgccgcatgaagtggaagaaagagcataaggacgaaggtccgactgccgccgcagctccc
gagggcgccgtgccctctgccgccgccactgctgccgcggacaaggccgacgaggaggac
gatgatgaagaagaggaagacgaggaggaatga

DBGET integrated database retrieval system