KEGG   Homo sapiens (human): 3205Help
Entry
3205              CDS       T01001                                 

Gene name
HOXA9, ABD-B, HOX1, HOX1.7, HOX1G
Definition
(RefSeq) homeobox A9
  KO
K21950  homeobox protein Hox-A9
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
N00119  MLL-AF4 fusion to transcriptional activation
N00120  MLL-ENL fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    3205 (HOXA9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3205 (HOXA9)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, AbdB
    3205 (HOXA9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hox9_act Homeodomain HTH_23
Motif
Other DBs
NCBI-GeneID: 3205
NCBI-ProteinID: NP_689952
OMIM: 142956
HGNC: 5109
Ensembl: ENSG00000078399
Vega: OTTHUMG00000023220
Pharos: P31269(Tbio)
UniProt: P31269
Position
7p15.2
AA seq 272 aa AA seqDB search
MATTGALGNYYVDSFLLGADAADELSVGRYAPGTLGQPPRQAATLAEHPDFSPCSFQSKA
TVFGASWNPVHAAGANAVPAAVYHHHHHHPYVHPQAPVAAAAPDGRYMRSWLEPTPGALS
FAGLPSSRPYGIKPEPLSARRGDCPTLDTHTLSLTDYACGSPPVDREKQPSEGAFSENNA
ENESGGDKPPIDPNNPAANWLHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVA
RLLNLTERQVKIWFQNRRMKMKKINKDRAKDE
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggccaccactggggccctgggcaactactacgtggactcgttcctgctgggcgccgac
gccgcggatgagctgagcgttggccgctatgcgccggggaccctgggccagcctccccgg
caggcggcgacgctggccgagcaccccgacttcagcccgtgcagcttccagtccaaggcg
acggtgtttggcgcctcgtggaacccagtgcacgcggcgggcgccaacgctgtacccgct
gcggtgtaccaccaccatcaccaccacccctacgtgcacccccaggcgcccgtggcggcg
gcggcgccggacggcaggtacatgcgctcctggctggagcccacgcccggtgcgctctcc
ttcgcgggcttgccctccagccggccttatggcattaaacctgaaccgctgtcggccaga
aggggtgactgtcccacgcttgacactcacactttgtccctgactgactatgcttgtggt
tctcctccagttgatagagaaaaacaacccagcgaaggcgccttctctgaaaacaatgct
gagaatgagagcggcggagacaagccccccatcgatcccaataacccagcagccaactgg
cttcatgcgcgctccactcggaaaaagcggtgcccctatacaaaacaccagaccctggaa
ctggagaaagagtttctgttcaacatgtacctcaccagggaccgcaggtacgaggtggct
cgactgctcaacctcaccgagaggcaggtcaagatctggttccagaaccgcaggatgaaa
atgaagaaaatcaacaaagaccgagcaaaagacgagtga

DBGET integrated database retrieval system