KEGG   Homo sapiens (human): 3206Help
Entry
3206              CDS       T01001                                 

Gene name
HOXA10, HOX1, HOX1.8, HOX1H, PL
Definition
(RefSeq) homeobox A10
  KO
K17443  homrobox protein Hox-A10
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
N00119  MLL-AF4 fusion to transcriptional activation
N00120  MLL-ENL fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    3206 (HOXA10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3206 (HOXA10)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, AbdB
    3206 (HOXA10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 3206
NCBI-ProteinID: NP_061824
OMIM: 142957
HGNC: 5100
Ensembl: ENSG00000253293
Vega: OTTHUMG00000023436
Pharos: P31260(Tbio)
UniProt: P31260
Position
7p15.2
AA seq 410 aa AA seqDB search
MSARKGYLLPSPNYPTTMSCSESPAANSFLVDSLISSGRGEAGGGGGGAGGGGGGGYYAH
GGVYLPPAADLPYGLQSCGLFPTLGGKRNEAASPGSGGGGGGLGPGAHGYGPSPIDLWLD
APRSCRMEPPDGPPPPPQQQPPPPPQPPQPAPQATSCSFAQNIKEESSYCLYDSADKCPK
VSATAAELAPFPRGPPPDGCALGTSSGVPVPGYFRLSQAYGTAKGYGSGGGGAQQLGAGP
FPAQPPGRGFDLPPALASGSADAARKERALDSPPPPTLACGSGGGSQGDEEAHASSSAAE
ELSPAPSESSKASPEKDSLGNSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMY
LTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccagaaagggctatctgctcccttcgccaaattatcccacaacaatgtcatgc
tcggagagccccgccgcgaactcttttttggtcgactcgctcatcagctcgggcagaggc
gaggcaggcggcggtggtggtggcgcggggggcggcggcggtggcggttactacgcccac
ggcggggtctacctgccgcccgccgccgacctgccctacgggctgcagagctgcgggctc
ttccccacgctgggcggcaagcgcaatgaggcagcgtcgccgggcagcggtggcggtggc
gggggtctaggtcccggggcgcacggctacgggccctcgcccatagacctgtggctagac
gcgccccggtcttgccggatggagccgcctgacgggccgccgccgccgccccagcagcag
ccgccgcccccgccgcaaccaccccagccagcgccgcaggccacctcgtgctctttcgcg
cagaacatcaaagaagagagctcctactgcctctacgactcggcggacaaatgccccaaa
gtctcggccaccgccgccgaactggctcccttcccgcggggcccgccgcccgacggctgc
gccctgggcacctccagcggggtgccagtgcctggctacttccgcctttctcaggcctac
ggcaccgccaagggctatggcagcggcggcggcggcgcgcagcaactcggggctggcccg
ttccccgcgcagcccccggggcgcggtttcgatctcccgcccgcgctagcctccggctcg
gccgatgcggcccggaaggagcgagccctcgattcgccgccgccccccacgctggcttgc
ggcagcggcgggggctcgcagggcgacgaggaggcgcacgcgtcgtcctcggccgcggag
gagctctccccggccccttccgagagcagcaaagcctcgccggagaaggattccctgggc
aattccaaaggtgaaaacgcagccaactggctcacggcaaagagtggtcggaagaagcgc
tgcccctacacgaagcaccagacactggagctggagaaggagtttctgttcaatatgtac
cttactcgagagcggcgcctagagattagccgcagcgtccacctcacggacagacaagtg
aaaatctggtttcagaaccgcaggatgaaactgaagaaaatgaatcgagaaaaccggatc
cgggagctcacagccaactttaatttttcctga

DBGET integrated database retrieval system