KEGG   Homo sapiens (human): 3209
Entry
3209              CDS       T01001                                 
Symbol
HOXA13, HOX1, HOX1J
Name
(RefSeq) homeobox A13
  KO
K09298  homeobox protein HoxA/B/C/D13
Organism
hsa  Homo sapiens (human)
Disease
H00460  Hand-foot-genital syndrome
H00859  Guttmacher syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3209 (HOXA13)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: HOXL
    3209 (HOXA13)
SSDB
Motif
Pfam: HoxA13_N Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 3209
NCBI-ProteinID: NP_000513
OMIM: 142959
HGNC: 5102
Ensembl: ENSG00000106031
Pharos: P31271(Tbio)
UniProt: P31271 Q6DI00
Structure
Position
7:complement(27194364..27200091)
AA seq 388 aa
MTASVLLHPRWIEPTVMFLYDNGGGLVADELNKNMEGAAAAAAAAAAAAAAGAGGGGFPH
PAAAAAGGNFSVAAAAAAAAAAAANQCRNLMAHPAPLAPGAASAYSSAPGEAPPSAAAAA
AAAAAAAAAAAAASSSGGPGPAGPAGAEAAKQCSPCSAAAQSSSGPAALPYGYFGSGYYP
CARMGPHPNAIKSCAQPASAAAAAAFADKYMDTAGPAAEEFSSRAKEFAFYHQGYAAGPY
HHHQPMPGYLDMPVVPGLGGPGESRHEPLGLPMESYQPWALPNGWNGQMYCPKEQAQPPH
LWKSTLPDVVSHPSDASSYRRGRKKRVPYTKVQLKELEREYATNKFITKDKRRRISATTN
LSERQVTIWFQNRRVKEKKVINKLKTTS
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgacagcctccgtgctcctccacccccgctggatcgagcccaccgtcatgtttctctac
gacaacggcggcggcctggtggccgacgagctcaacaagaacatggaaggggcggcggcg
gctgcagcagcggctgcagcggcggcggctgccggggccgggggcgggggcttcccccac
ccggcggctgcggcggcagggggcaacttctcggtggcggcggcggccgcggctgcggcg
gcggccgcggccaaccagtgccgcaacctgatggcgcacccggcgcccttggcgccagga
gccgcgtccgcctacagcagcgcccccggggaggcgcccccgtcggctgccgccgctgct
gccgcggctgccgctgcagccgccgccgccgccgccgcgtcgtcctcgggaggtcccggc
ccggcgggcccggcgggcgcagaggccgccaagcaatgcagcccctgctcggcagcggcg
cagagctcgtcggggcccgcggcgctgccctatggctacttcggcagcggctactacccg
tgcgcccgcatgggcccgcaccccaacgccatcaagtcgtgcgcgcagcccgcctcggcc
gccgccgccgccgccttcgcggacaagtacatggataccgccggcccagctgccgaggag
ttcagctcccgcgctaaggagttcgccttctaccaccagggctacgcagccgggccttac
caccaccatcagcccatgcctggctacctggatatgccagtggtgccgggcctcgggggc
cccggcgagtcgcgccacgaacccttgggtcttcccatggaaagctaccagccctgggcg
ctgcccaacggctggaacggccaaatgtactgccccaaagagcaggcgcagcctccccac
ctctggaagtccactctgcccgacgtggtctcccatccctcggatgccagctcctatagg
agggggagaaagaagcgcgtgccttataccaaggtgcaattaaaagaacttgaacgggaa
tacgccacgaataaattcattactaaggacaaacggaggcggatatcagccacgacgaat
ctctctgagcggcaggtcacaatctggttccagaacaggagggttaaagagaaaaaagtc
atcaacaaactgaaaaccactagttaa

DBGET integrated database retrieval system