KEGG   Homo sapiens (human): 321
Entry
321               CDS       T01001                                 
Symbol
APBA2, D15S1518E, HsT16821, LIN-10, MGC:14091, MINT2, X11-BETA, X11L
Name
(RefSeq) amyloid beta precursor protein binding family A member 2
  KO
K20055  amyloid beta A4 precursor protein-binding family A member 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    321 (APBA2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    321 (APBA2)
SSDB
Motif
Pfam: PID PDZ PDZ_6 PDZ_2 NRho
Other DBs
NCBI-GeneID: 321
NCBI-ProteinID: NP_005494
OMIM: 602712
HGNC: 579
Ensembl: ENSG00000034053
Pharos: Q99767(Tbio)
UniProt: Q99767 Q59G28
Position
15:28885974..29118315
AA seq 749 aa
MAHRKLESVGSGMLDHRVRPGPVPHSQEPESEDMELPLEGYVPEGLELAALRPESPAPEE
QECHNHSPDGDSSSDYVNNTSEEEDYDEGLPEEEEGITYYIRYCPEDDSYLEGMDCNGEE
YLAHSAHPVDTDECQEAVEEWTDSAGPHPHGHEAEGSQDYPDGQLPIPEDEPSVLEAHDQ
EEDGHYCASKEGYQDYYPEEANGNTGASPYRLRRGDGDLEDQEEDIDQIVAEIKMSLSMT
SITSASEASPEHGPEPGPEDSVEACPPIKASCSPSRHEARPKSLNLLPEAKHPGDPQRGF
KPKTRTPEERLKWPHEQVCNGLEQPRKQQRSDLNGPVDNNNIPETKKVASFPSFVAVPGP
CEPEDLIDGIIFAANYLGSTQLLSERNPSKNIRMMQAQEAVSRVKRMQKAAKIKKKANSE
GDAQTLTEVDLFISTQRIKVLNADTQETMMDHALRTISYIADIGNIVVLMARRRMPRSAS
QDCIETTPGAQEGKKQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINPEDLSQ
KEYSDIINTQEMYNDDLIHFSNSENCKELQLEKHKGEILGVVVVESGWGSILPTVILANM
MNGGPAARSGKLSIGDQIMSINGTSLVGLPLATCQGIIKGLKNQTQVKLNIVSCPPVTTV
LIKRPDLKYQLGFSVQNGIICSLMRGGIAERGGVRVGHRIIEINGQSVVATAHEKIVQAL
SNSVGEIHMKTMPAAMFRLLTGQETPLYI
NT seq 2250 nt   +upstreamnt  +downstreamnt
atggcccaccggaagcttgagagcgtggggagcggcatgttggaccatagggtgagacca
ggtcctgtccctcacagccaggagcccgagagcgaggacatggagctgcccttggagggc
tatgtgcccgagggcctggagctggctgccctgcggccagagagccccgcgccagaggaa
caggagtgccacaaccacagccccgatggggactccagctctgactacgtgaacaacacc
tctgaggaggaggactatgacgagggcctccctgaggaggaggagggcatcacctactac
atccgctactgccctgaggacgacagctacctagagggcatggactgcaacggggaggag
tacctggcccacagtgcacaccctgtggacactgatgagtgccaggaggcggtggaggag
tggacggactcggcgggcccgcacccccacggccacgaggctgaaggcagccaggactac
ccagacggccaactgcccattccggaggatgagccctccgtccttgaggcccatgaccag
gaagaagatggtcactactgtgccagcaaagagggctaccaggactactaccccgaggag
gccaacgggaacaccggcgcctccccctaccgcctgaggcgtggggatggggacctggag
gaccaggaggaggacattgaccagatcgtggcagagatcaagatgagtctgagcatgacc
agcatcaccagcgccagtgaggccagccccgagcatgggcctgagccagggcctgaggac
tctgtagaggcctgcccacccatcaaggccagctgcagccccagcaggcacgaggcgagg
cccaagtcgctgaacctccttcccgaggccaagcaccccggagacccccagagaggcttc
aagcccaagaccaggaccccagaagagaggctgaagtggccccacgagcaggtttgcaat
ggtctggagcagccaaggaagcagcagcgctctgatctcaatggacctgttgacaataac
aacattccagagacaaagaaggtggcatcatttccaagttttgtggctgttccagggccc
tgcgaaccagaagacctcatcgacgggatcatctttgctgccaattacctggggtccacc
cagctgctatcagaacggaacccttccaaaaacatcagaatgatgcaagcgcaggaggcc
gtcagccgggtcaagaggatgcaaaaggctgctaagatcaagaaaaaagcgaattctgag
ggggatgcccagacgctgacggaagtggacctcttcatttccacccagaggatcaaggtt
ttaaatgcagacacgcaggaaaccatgatggaccacgccttgcgtaccatctcctacatc
gccgacattgggaacattgtagtgctgatggccagacgccgcatgccccggtcagcctct
caggactgcatcgagaccacgcccggggcccaggaaggcaagaagcagtataagatgatc
tgccatgtgttcgagtcggaggatgcccagctcatcgcccagtctatcggccaggccttc
agcgtggcctaccaggagttcctgcgagccaatggcatcaaccccgaagacttgagccag
aaggaatacagcgacatcatcaacacccaggagatgtacaacgacgacctcatccacttc
tcaaactcggagaactgcaaggagctgcagctggagaagcacaagggcgagatcctgggc
gtggtggtggtggagtcgggctggggctccatcctgcccacggtgatcctggccaacatg
atgaatggcggcccggctgcccgctcggggaagctgagcatcggggaccagatcatgtcc
atcaatggcaccagcctggtggggctgcccctcgccacctgccaaggcatcatcaagggc
ctgaagaaccagacacaggtgaagctcaacattgtcagctgtcccccggtcaccacggtc
cttatcaagcggccagacctcaagtaccagctgggcttcagcgtgcagaatggaattatc
tgcagcctcatgagagggggcattgctgagcgagggggcgtccgtgtgggccaccgcatc
atcgagatcaacgggcagagcgtggtggccacagcccacgagaagatagtccaagctctg
tccaactcggtcggagagatccacatgaagaccatgcccgccgccatgttcaggctcctc
acgggtcaggagaccccgctgtacatctag

DBGET integrated database retrieval system