KEGG   Homo sapiens (human): 3214Help
Entry
3214              CDS       T01001                                 

Gene name
HOXB4, HOX-2.6, HOX2, HOX2F
Definition
(RefSeq) homeobox B4
  KO
K09304  homeobox protein HoxA/B/C/D4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3214 (HOXB4)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, Antp
    3214 (HOXB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain DUF2209 HTH_23
Motif
Other DBs
NCBI-GeneID: 3214
NCBI-ProteinID: NP_076920
OMIM: 142965
HGNC: 5115
Ensembl: ENSG00000182742
Vega: OTTHUMG00000159920
Pharos: P17483(Tbio)
UniProt: P17483
Position
17q21.32
AA seq 251 aa AA seqDB search
MAMSSFLINSNYVDPKFPPCEEYSQSDYLPSDHSPGYYAGGQRRESSFQPEAGFGRRAAC
TVQRYAACRDPGPPPPPPPPPPPPPPPGLSPRAPAPPPAGALLPEPGQRCEAVSSSPPPP
PCAQNPLHPSPSHSACKEPVVYPWMRKVHVSTVNPNYAGGEPKRSRTAYTRQQVLELEKE
FHYNRYLTRRRRVEIAHALCLSERQIKIWFQNRRMKWKKDHKLPNTKIRSGGAAGSAGGP
PGRPNGGPRAL
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggctatgagttcttttttgatcaactcaaactatgtcgaccccaagttccctccatgc
gaggaatattcacagagcgattacctacccagcgaccactcgcccgggtactacgccggc
ggccagaggcgagagagcagcttccagccggaggcgggcttcgggcggcgcgcggcgtgc
accgtgcagcgctacgcggcctgccgggaccctgggcccccgccgcctccgccaccaccc
ccgccgcccccgccaccgcccggtctgtcccctcgggctcctgcgccgccacccgccggg
gccctcctcccggagcccggccagcgctgcgaggcggtcagcagcagccccccgccgcct
ccctgcgcccagaaccccctgcaccccagcccgtcccactccgcgtgcaaagagcccgtc
gtctacccctggatgcgcaaagttcacgtgagcacggtaaaccccaattacgccggcggg
gagcccaagcgctctcggaccgcctacacgcgccagcaggtcttggagctggagaaggaa
tttcactacaaccgctacctgacacggcgccggagggtggagatcgcccacgcgctctgc
ctctccgagcgccagatcaagatctggttccagaaccggcgcatgaagtggaaaaaagac
cacaagttgcccaacaccaagatccgctcgggtggtgcggcaggctcagccggagggccc
cctggccggcccaatggaggcccccgcgcgctctag

DBGET integrated database retrieval system