KEGG   Homo sapiens (human): 3216Help
Entry
3216              CDS       T01001                                 

Gene name
HOXB6, HOX2, HOX2B, HU-2, Hox-2.2
Definition
(RefSeq) homeobox B6
  KO
K09306  homeobox protein HoxA/B/C6
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3216 (HOXB6)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, Antp
    3216 (HOXB6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain DUF2209 Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 3216
NCBI-ProteinID: NP_061825
OMIM: 142961
HGNC: 5117
Ensembl: ENSG00000108511
Vega: OTTHUMG00000159912
Pharos: P17509(Tbio)
UniProt: P17509
Position
17q21.32
AA seq 224 aa AA seqDB search
MSSYFVNSTFPVTLASGQESFLGQLPLYSSGYADPLRHYPAPYGPGPGQDKGFATSSYYP
PAGGGYGRAAPCDYGPAPAFYREKESACALSGADEQPPFHPEPRKSDCAQDKSVFGETEE
QKCSTPVYPWMQRMNSCNSSSFGPSGRRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIA
HALCLTERQIKIWFQNRRMKWKKESKLLSASQLSAEEEEEKQAE
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgagttcctatttcgtgaactccaccttccccgtcactctggccagcgggcaggagtcc
ttcctgggccagctaccgctctattcgtcgggctatgcggacccgctgagacattacccc
gcgccctacgggccagggccgggccaggacaagggctttgccacttcctcctattacccg
ccggcgggcggtggctacggccgagcggcgccctgcgactacgggccggcgccggccttc
taccgcgagaaagagtcggcctgcgcactctccggcgccgacgagcagcccccgttccac
cccgagccgcggaagtcggactgcgcgcaggacaagagcgtgttcggcgagacagaagag
cagaagtgctccactccggtctacccgtggatgcagcggatgaattcgtgcaacagttcc
tcctttgggcccagcggccggcgaggccgccagacatacacacgttaccagacgctggag
ctggagaaggagtttcactacaatcgctacctgacgcggcggcggcgcatcgagatcgcg
cacgccctgtgcctgacggagaggcagatcaagatatggttccagaaccgacgcatgaag
tggaaaaaggagagcaaactgctcagcgcgtctcagctcagtgccgaggaggaggaagaa
aaacaggccgagtga

DBGET integrated database retrieval system