KEGG   Homo sapiens (human): 3221
Entry
3221              CDS       T01001                                 
Symbol
HOXC4, HOX3, HOX3E, cp19
Name
(RefSeq) homeobox C4
  KO
K09304  homeobox protein HoxA/B/C/D4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3221 (HOXC4)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: HOXL
    3221 (HOXC4)
SSDB
Motif
Pfam: Homeodomain DUF2209 Homeobox_KN
Other DBs
NCBI-GeneID: 3221
NCBI-ProteinID: NP_055435
OMIM: 142974
HGNC: 5126
Ensembl: ENSG00000198353
Pharos: P09017(Tbio)
UniProt: P09017 A0A024RB51 Q86TF7
Position
12:54016888..54056030
AA seq 264 aa
MIMSSYLMDSNYIDPKFPPCEEYSQNSYIPEHSPEYYGRTRESGFQHHHQELYPPPPPRP
SYPERQYSCTSLQGPGNSRGHGPAQAGHHHPEKSQSLCEPAPLSGASASPSPAPPACSQP
APDHPSSAASKQPIVYPWMKKIHVSTVNPNYNGGEPKRSRTAYTRQQVLELEKEFHYNRY
LTRRRRIEIAHSLCLSERQIKIWFQNRRMKWKKDHRLPNTKVRSAPPAGAAPSTLSAATP
GTSEDHSQSATPPEQQRAEDITRL
NT seq 795 nt   +upstreamnt  +downstreamnt
atgatcatgagctcgtatttgatggactctaactacatcgatccgaaatttcctccatgc
gaagaatattcgcaaaatagctacatccctgaacacagtccggaatattacggccggacc
agggaatcgggattccagcatcaccaccaggagctgtacccaccaccgcctccgcgccct
agctaccctgagcgccagtatagctgcaccagtctccaggggcccggcaattcgcgaggc
cacgggccggcccaggcgggccaccaccaccccgagaaatcacagtcgctctgcgagccg
gcgcctctctcaggcgcctccgcctccccgtccccagccccgccagcctgcagccagcca
gcccccgaccatccctccagcgccgccagcaagcaacccatagtctacccatggatgaaa
aaaattcacgttagcacggtgaaccccaattataacggaggggaacccaagcgctcgagg
acagcctatacccggcagcaagtcctggaattagagaaagagtttcattacaaccgctac
ctgacccgaaggagaaggatcgagatcgcccactcgctgtgcctctctgagaggcagatc
aaaatctggttccaaaaccgtcgcatgaaatggaagaaggaccaccgactccccaacacc
aaagtcaggtcagcacccccggccggcgctgcgcccagcaccctttcggcagctaccccg
ggtacttctgaagaccactcccagagcgccacgccgccggagcagcaacgggcagaggac
attaccaggttataa

DBGET integrated database retrieval system