KEGG   Homo sapiens (human): 3224Help
Entry
3224              CDS       T01001                                 

Gene name
HOXC8, HOX3, HOX3A
Definition
(RefSeq) homeobox C8
  KO
K09308  homeobox protein HoxB/C/D8
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3224 (HOXC8)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, Antp
    3224 (HOXC8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeobox Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 3224
NCBI-ProteinID: NP_073149
OMIM: 142970
HGNC: 5129
Ensembl: ENSG00000037965
Vega: OTTHUMG00000160032
Pharos: P31273(Tbio)
UniProt: P31273
Position
12q13.13
AA seq 242 aa AA seqDB search
MSSYFVNPLFSKYKAGESLEPAYYDCRFPQSVGRSHALVYGPGGSAPGFQHASHHVQDFF
HHGTSGISNSGYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANT
NSSEGQGHLNQNSSPSLMFPWMRPHAPGRRSGRQTYSRYQTLELEKEFLFNPYLTRKRRI
EVSHALGLTERQVKIWFQNRRMKWKKENNKDKLPGARDEEKVEEEGNEEEEKEEEEKEEN
KD
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgagctcctacttcgtcaaccccctgttctccaaatacaaagccggcgagtccctggaa
ccggcctattacgactgccggttccctcagagcgtgggcaggagccatgcgctggtgtac
gggcccggcggctcggcgcccggcttccagcacgcttcgcaccacgttcaagacttcttc
caccacggcacctccggcatctccaactcaggctaccagcagaacccgtgctcgcttagc
tgccacggagacgcctccaaattctatggctacgaggcgctccccagacagtccctttat
ggggctcagcaagaggcgagcgtggtgcaatatcccgactgtaaatcctccgccaacact
aacagtagcgaaggacaaggccacttaaatcaaaactcgtctcccagcctcatgtttcca
tggatgagaccccacgctccggggaggcgcagtggacggcaaacttacagccggtatcag
accttggaactagaaaaggagtttctctttaatccttatttgacacgaaaacgtcggatt
gaagtctctcatgccctgggactgaccgagagacaagtgaagatctggttccagaaccga
aggatgaagtggaaaaaggagaacaacaaggataaactgccgggagcccgagatgaggag
aaggtggaggaagaaggaaatgaggaagaggagaaagaagaggaggaaaaggaagaaaac
aaggactaa

DBGET integrated database retrieval system