KEGG   Homo sapiens (human): 3232Help
Entry
3232              CDS       T01001                                 

Gene name
HOXD3, HOX1D, HOX4, HOX4A, Hox-4.1
Definition
(RefSeq) homeobox D3
  KO
K09303  homeobox protein HoxA/B/D3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3232 (HOXD3)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Antp
    3232 (HOXD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4074 Homeodomain
Motif
Other DBs
NCBI-GeneID: 3232
NCBI-ProteinID: NP_008829
OMIM: 142980
HGNC: 5137
Ensembl: ENSG00000128652
Vega: OTTHUMG00000187566
Pharos: P31249(Tbio)
UniProt: P31249
Position
2q31.1
AA seq 432 aa AA seqDB search
MLFEQGQQALELPECTMQKAAYYENPGLFGGYGYSKTTDTYGYSTPHQPYPPPAAASSLD
TDYPGSACSIQSSAPLRAPAHKGAELNGSCMRPGTGNSQGGGGGSQPPGLNSEQQPPQPP
PPPPTLPPSSPTNPGGGVPAKKPKGGPNASSSSATISKQIFPWMKESRQNSKQKNSCATA
GESCEDKSPPGPASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKI
WFQNRRMKYKKDQKAKGILHSPASQSPERSPPLGGAAGHVAYSGQLPPVPGLAYDAPSPP
AFAKSQPNMYGLAAYTAPLSSCLPQQKRYAAPEFEPHPMASNGGGFASANLQGSPVYVGG
NFVESMAPASGPVFNLGHLSHPSSASVDYSCAAQIPGNHHHGPCDPHPTYTDLSAHHSSQ
GRLPEAPKLTHL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgttatttgagcagggtcagcaggccctggagcttcctgagtgcacaatgcagaaggct
gcttactatgaaaacccaggactgtttggaggctatggctacagcaaaactacggacact
tacggctacagcaccccccaccagccctacccaccccctgctgctgccagctccctggac
actgactatccaggttctgcctgctccatccagagctctgcccctctgagagccccagcc
cacaaaggagctgaactcaatggcagctgcatgcggccgggcactgggaacagccagggt
gggggtggtggcagccagcctcctggtctgaactcagagcagcagccaccacaaccccct
cctccaccaccgaccctgcccccatcttcacccaccaatcctggaggtggagtgcctgcc
aagaagcccaaaggtgggcccaatgcttctagctcctcagccaccatcagcaagcagatc
ttcccctggatgaaagagtctcgacagaactccaagcagaagaacagctgtgccactgca
ggagagagctgcgaggacaagagcccgccaggcccagcatccaagcgggtacgcacggca
tacacgagcgcgcagctggtggaattggaaaaggaattccacttcaaccgctacttgtgc
cggccgcgccgcgtggagatggccaacctgctgaatctcacggaacgccagatcaagatc
tggttccagaaccggcgcatgaagtacaagaaggaccagaaggccaagggcatcctgcac
tcgccggctagccagtcccctgagcgcagcccaccgctcggcggcgccgctggccacgtg
gcctactccggccagctgccgccagtgcccggcctggcctacgacgcgccctcgccgcct
gctttcgccaaatcacagcccaatatgtacggcctggccgcctacacggcgccactcagc
agctgcctgccacaacagaagcgctacgcagcgccggagttcgagccccatcccatggcg
agcaacggcggcggcttcgccagcgccaacttgcagggcagcccggtgtacgtgggcggc
aacttcgtcgagtccatggcgcccgcgtccgggcctgtcttcaacctgggccacctctcg
cacccgtcgtcggccagcgtggactacagttgcgccgcgcagattccaggcaaccaccac
catggaccttgcgaccctcatcccacctacacagatctctcggcccaccactcgtctcag
ggacgactgccggaggctcccaaactgacgcatctgtag

DBGET integrated database retrieval system