KEGG   Homo sapiens (human): 324Help
Entry
324               CDS       T01001                                 

Gene name
APC, BTPS2, DP2, DP2.5, DP3, GS, PPP1R46
Definition
(RefSeq) APC, WNT signaling pathway regulator
  KO
K02085  adenomatosis polyposis coli protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04810  Regulation of actin cytoskeleton
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05166  HTLV-I infection
hsa05200  Pathways in cancer
hsa05206  MicroRNAs in cancer
hsa05210  Colorectal cancer
hsa05213  Endometrial cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
N00056  Wnt signaling pathway
N00057  Mutation-inactivated APC to Wnt signaling pathway
N00058  Mutation-activated CTNNB1 to Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
N00242  Mutation-inactivated AXIN to Wnt signaling pathway
Disease
H00017  Esophageal cancer
H00018  Gastric cancer
H00044  Cancer of the anal canal
H00047  Gallbladder cancer
H01025  Familial adenomatous polyposis
H01431  Cushing syndrome
H01667  Medulloblastoma
H02049  Bilateral macronodular adrenal hyperplasia (BMAH)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    324 (APC)
   04390 Hippo signaling pathway
    324 (APC)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    324 (APC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    324 (APC)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    324 (APC)
   05206 MicroRNAs in cancer
    324 (APC)
   05210 Colorectal cancer
    324 (APC)
   05225 Hepatocellular carcinoma
    324 (APC)
   05226 Gastric cancer
    324 (APC)
   05217 Basal cell carcinoma
    324 (APC)
   05213 Endometrial cancer
    324 (APC)
   05224 Breast cancer
    324 (APC)
  09166 Endocrine and metabolic diseases
   04934 Cushing syndrome
    324 (APC)
  09167 Infectious diseases
   05166 HTLV-I infection
    324 (APC)
   05165 Human papillomavirus infection
    324 (APC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:hsa01009]
    324 (APC)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    324 (APC)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    324 (APC)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     324 (APC)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    324 (APC)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     324 (APC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arm_APC_u3 APC_basic EB1_binding APC_r APC_u5 APC_u14 APC_u15 APC_u9 SAMP APC_N_CC Arm APC_u13 APC_15aa Suppressor_APC JIP_LZII
Motif
Other DBs
NCBI-GeneID: 324
NCBI-ProteinID: NP_000029
OMIM: 611731
HGNC: 583
Ensembl: ENSG00000134982
Vega: OTTHUMG00000128806
Pharos: P25054(Tbio)
UniProt: P25054 Q4LE70
Structure
PDB: 

Position
5q22.2
AA seq 2843 aa AA seqDB search
MAAASYDQLLKQVEALKMENSNLRQELEDNSNHLTKLETEASNMKEVLKQLQGSIEDEAM
ASSGQIDLLERLKELNLDSSNFPGVKLRSKMSLRSYGSREGSVSSRSGECSPVPMGSFPR
RGFVNGSRESTGYLEELEKERSLLLADLDKEEKEKDWYYAQLQNLTKRIDSLPLTENFSL
QTDMTRRQLEYEARQIRVAMEEQLGTCQDMEKRAQRRIARIQQIEKDILRIRQLLQSQAT
EAERSSQNKHETGSHDAERQNEGQGVGEINMATSGNGQGSTTRMDHETASVLSSSSTHSA
PRRLTSHLGTKVEMVYSLLSMLGTHDKDDMSRTLLAMSSSQDSCISMRQSGCLPLLIQLL
HGNDKDSVLLGNSRGSKEARARASAALHNIIHSQPDDKRGRREIRVLHLLEQIRAYCETC
WEWQEAHEPGMDQDKNPMPAPVEHQICPAVCVLMKLSFDEEHRHAMNELGGLQAIAELLQ
VDCEMYGLTNDHYSITLRRYAGMALTNLTFGDVANKATLCSMKGCMRALVAQLKSESEDL
QQVIASVLRNLSWRADVNSKKTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHCT
ENKADICAVDGALAFLVGTLTYRSQTNTLAIIESGGGILRNVSSLIATNEDHRQILRENN
CLQTLLQHLKSHSLTIVSNACGTLWNLSARNPKDQEALWDMGAVSMLKNLIHSKHKMIAM
GSAAALRNLMANRPAKYKDANIMSPGSSLPSLHVRKQKALEAELDAQHLSETFDNIDNLS
PKASHRSKQRHKQSLYGDYVFDTNRHDDNRSDNFNTGNMTVLSPYLNTTVLPSSSSSRGS
LDSSRSEKDRSLERERGIGLGNYHPATENPGTSSKRGLQISTTAAQIAKVMEEVSAIHTS
QEDRSSGSTTELHCVTDERNALRRSSAAHTHSNTYNFTKSENSNRTCSMPYAKLEYKRSS
NDSLNSVSSSDGYGKRGQMKPSIESYSEDDESKFCSYGQYPADLAHKIHSANHMDDNDGE
LDTPINYSLKYSDEQLNSGRQSPSQNERWARPKHIIEDEIKQSEQRQSRNQSTTYPVYTE
STDDKHLKFQPHFGQQECVSPYRSRGANGSETNRVGSNHGINQNVSQSLCQEDDYEDDKP
TNYSERYSEEEQHEEEERPTNYSIKYNEEKRHVDQPIDYSLKYATDIPSSQKQSFSFSKS
SSGQSSKTEHMSSSSENTSTPSSNAKRQNQLHPSSAQSRSGQPQKAATCKVSSINQETIQ
TYCVEDTPICFSRCSSLSSLSSAEDEIGCNQTTQEADSANTLQIAEIKEKIGTRSAEDPV
SEVPAVSQHPRTKSSRLQGSSLSSESARHKAVEFSSGAKSPSKSGAQTPKSPPEHYVQET
PLMFSRCTSVSSLDSFESRSIASSVQSEPCSGMVSGIISPSDLPDSPGQTMPPSRSKTPP
PPPQTAQTKREVPKNKAPTAEKRESGPKQAAVNAAVQRVQVLPDADTLLHFATESTPDGF
SCSSSLSALSLDEPFIQKDVELRIMPPVQENDNGNETESEQPKESNENQEKEAEKTIDSE
KDLLDDSDDDDIEILEECIISAMPTKSSRKAKKPAQTASKLPPPVARKPSQLPVYKLLPS
QNRLQPQKHVSFTPGDDMPRVYCVEGTPINFSTATSLSDLTIESPPNELAAGEGVRGGAQ
SGEFEKRDTIPTEGRSTDEAQGGKTSSVTIPELDDNKAEEGDILAECINSAMPKGKSHKP
FRVKKIMDQVQQASASSSAPNKNQLDGKKKKPTSPVKPIPQNTEYRTRVRKNADSKNNLN
AERVFSDNKDSKKQNLKNNSKVFNDKLPNNEDRVRGSFAFDSPHHYTPIEGTPYCFSRND
SLSSLDFDDDDVDLSREKAELRKAKENKESEAKVTSHTELTSNQQSANKTQAIAKQPINR
GQPKPILQKQSTFPQSSKDIPDRGAATDEKLQNFAIENTPVCFSHNSSLSSLSDIDQENN
NKENEPIKETEPPDSQGEPSKPQASGYAPKSFHVEDTPVCFSRNSSLSSLSIDSEDDLLQ
ECISSAMPKKKKPSRLKGDNEKHSPRNMGGILGEDLTLDLKDIQRPDSEHGLSPDSENFD
WKAIQEGANSIVSSLHQAAAAACLSRQASSDSDSILSLKSGISLGSPFHLTPDQEEKPFT
SNKGPRILKPGEKSTLETKKIESESKGIKGGKKVYKSLITGKVRSNSEISGQMKQPLQAN
MPSISRGRTMIHIPGVRNSSSSTSPVSKKGPPLKTPASKSPSEGQTATTSPRGAKPSVKS
ELSPVARQTSQIGGSSKAPSRSGSRDSTPSRPAQQPLSRPIQSPGRNSISPGRNGISPPN
KLSQLPRTSSPSTASTKSSGSGKMSYTSPGRQMSQQNLTKQTGLSKNASSIPRSESASKG
LNQMNNGNGANKKVELSRMSSTKSSGSESDRSERPVLVRQSTFIKEAPSPTLRRKLEESA
SFESLSPSSRPASPTRSQAQTPVLSPSLPDMSLSTHSSVQAGGWRKLPPNLSPTIEYNDG
RPAKRHDIARSHSESPSRLPINRSGTWKREHSKHSSSLPRVSTWRRTGSSSSILSASSES
SEKAKSEDEKHVNSISGTKQSKENQVSAKGTWRKIKENEFSPTNSTSQTVSSGATNGAES
KTLIYQMAPAVSKTEDVWVRIEDCPINNPRSGRSPTGNTPPVIDSVSEKANPNIKDSKDN
QAKQNVGNGSVPMRTVGLENRLNSFIQVDAPDQKGTEIKPGQNNPVPVSETNESSIVERT
PFSSSSSSKHSSPSGTVAARVTPFNYNPSPRKSSADSTSARPSQIPTPVNNNTKKRDSKT
DSTESSGTQSPKRHSGSYLVTSV
NT seq 8532 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagcttcatatgatcagttgttaaagcaagttgaggcactgaagatggagaac
tcaaatcttcgacaagagctagaagataattccaatcatcttacaaaactggaaactgag
gcatctaatatgaaggaagtacttaaacaactacaaggaagtattgaagatgaagctatg
gcttcttctggacagattgatttattagagcgtcttaaagagcttaacttagatagcagt
aatttccctggagtaaaactgcggtcaaaaatgtccctccgttcttatggaagccgggaa
ggatctgtatcaagccgttctggagagtgcagtcctgttcctatgggttcatttccaaga
agagggtttgtaaatggaagcagagaaagtactggatatttagaagaacttgagaaagag
aggtcattgcttcttgctgatcttgacaaagaagaaaaggaaaaagactggtattacgct
caacttcagaatctcactaaaagaatagatagtcttcctttaactgaaaatttttcctta
caaacagatatgaccagaaggcaattggaatatgaagcaaggcaaatcagagttgcgatg
gaagaacaactaggtacctgccaggatatggaaaaacgagcacagcgaagaatagccaga
attcagcaaatcgaaaaggacatacttcgtatacgacagcttttacagtcccaagcaaca
gaagcagagaggtcatctcagaacaagcatgaaaccggctcacatgatgctgagcggcag
aatgaaggtcaaggagtgggagaaatcaacatggcaacttctggtaatggtcagggttca
actacacgaatggaccatgaaacagccagtgttttgagttctagtagcacacactctgca
cctcgaaggctgacaagtcatctgggaaccaaggtggaaatggtgtattcattgttgtca
atgcttggtactcatgataaggatgatatgtcgcgaactttgctagctatgtctagctcc
caagacagctgtatatccatgcgacagtctggatgtcttcctctcctcatccagctttta
catggcaatgacaaagactctgtattgttgggaaattcccggggcagtaaagaggctcgg
gccagggccagtgcagcactccacaacatcattcactcacagcctgatgacaagagaggc
aggcgtgaaatccgagtccttcatcttttggaacagatacgcgcttactgtgaaacctgt
tgggagtggcaggaagctcatgaaccaggcatggaccaggacaaaaatccaatgccagct
cctgttgaacatcagatctgtcctgctgtgtgtgttctaatgaaactttcatttgatgaa
gagcatagacatgcaatgaatgaactagggggactacaggccattgcagaattattgcaa
gtggactgtgaaatgtatgggcttactaatgaccactacagtattacactaagacgatat
gctggaatggctttgacaaacttgacttttggagatgtagccaacaaggctacgctatgc
tctatgaaaggctgcatgagagcacttgtggcccaactaaaatctgaaagtgaagactta
cagcaggttattgcgagtgttttgaggaatttgtcttggcgagcagatgtaaatagtaaa
aagacgttgcgagaagttggaagtgtgaaagcattgatggaatgtgctttagaagttaaa
aaggaatcaaccctcaaaagcgtattgagtgccttatggaatttgtcagcacattgcact
gagaataaagctgatatatgtgctgtagatggtgcacttgcatttttggttggcactctt
acttaccggagccagacaaacactttagccattattgaaagtggaggtgggatattacgg
aatgtgtccagcttgatagctacaaatgaggaccacaggcaaatcctaagagagaacaac
tgtctacaaactttattacaacacttaaaatctcatagtttgacaatagtcagtaatgca
tgtggaactttgtggaatctctcagcaagaaatcctaaagaccaggaagcattatgggac
atgggggcagttagcatgctcaagaacctcattcattcaaagcacaaaatgattgctatg
ggaagtgctgcagctttaaggaatctcatggcaaataggcctgcgaagtacaaggatgcc
aatattatgtctcctggctcaagcttgccatctcttcatgttaggaaacaaaaagcccta
gaagcagaattagatgctcagcacttatcagaaacttttgacaatatagacaatttaagt
cccaaggcatctcatcgtagtaagcagagacacaagcaaagtctctatggtgattatgtt
tttgacaccaatcgacatgatgataataggtcagacaattttaatactggcaacatgact
gtcctttcaccatatttgaatactacagtgttacccagctcctcttcatcaagaggaagc
ttagatagttctcgttctgaaaaagatagaagtttggagagagaacgcggaattggtcta
ggcaactaccatccagcaacagaaaatccaggaacttcttcaaagcgaggtttgcagatc
tccaccactgcagcccagattgccaaagtcatggaagaagtgtcagccattcatacctct
caggaagacagaagttctgggtctaccactgaattacattgtgtgacagatgagagaaat
gcacttagaagaagctctgctgcccatacacattcaaacacttacaatttcactaagtcg
gaaaattcaaataggacatgttctatgccttatgccaaattagaatacaagagatcttca
aatgatagtttaaatagtgtcagtagtagtgatggttatggtaaaagaggtcaaatgaaa
ccctcgattgaatcctattctgaagatgatgaaagtaagttttgcagttatggtcaatac
ccagccgacctagcccataaaatacatagtgcaaatcatatggatgataatgatggagaa
ctagatacaccaataaattatagtcttaaatattcagatgagcagttgaactctggaagg
caaagtccttcacagaatgaaagatgggcaagacccaaacacataatagaagatgaaata
aaacaaagtgagcaaagacaatcaaggaatcaaagtacaacttatcctgtttatactgag
agcactgatgataaacacctcaagttccaaccacattttggacagcaggaatgtgtttct
ccatacaggtcacggggagccaatggttcagaaacaaatcgagtgggttctaatcatgga
attaatcaaaatgtaagccagtctttgtgtcaagaagatgactatgaagatgataagcct
accaattatagtgaacgttactctgaagaagaacagcatgaagaagaagagagaccaaca
aattatagcataaaatataatgaagagaaacgtcatgtggatcagcctattgattatagt
ttaaaatatgccacagatattccttcatcacagaaacagtcattttcattctcaaagagt
tcatctggacaaagcagtaaaaccgaacatatgtcttcaagcagtgagaatacgtccaca
ccttcatctaatgccaagaggcagaatcagctccatccaagttctgcacagagtagaagt
ggtcagcctcaaaaggctgccacttgcaaagtttcttctattaaccaagaaacaatacag
acttattgtgtagaagatactccaatatgtttttcaagatgtagttcattatcatctttg
tcatcagctgaagatgaaataggatgtaatcagacgacacaggaagcagattctgctaat
accctgcaaatagcagaaataaaagaaaagattggaactaggtcagctgaagatcctgtg
agcgaagttccagcagtgtcacagcaccctagaaccaaatccagcagactgcagggttct
agtttatcttcagaatcagccaggcacaaagctgttgaattttcttcaggagcgaaatct
ccctccaaaagtggtgctcagacacccaaaagtccacctgaacactatgttcaggagacc
ccactcatgtttagcagatgtacttctgtcagttcacttgatagttttgagagtcgttcg
attgccagctccgttcagagtgaaccatgcagtggaatggtaagtggcattataagcccc
agtgatcttccagatagccctggacaaaccatgccaccaagcagaagtaaaacacctcca
ccacctcctcaaacagctcaaaccaagcgagaagtacctaaaaataaagcacctactgct
gaaaagagagagagtggacctaagcaagctgcagtaaatgctgcagttcagagggtccag
gttcttccagatgctgatactttattacattttgccacggaaagtactccagatggattt
tcttgttcatccagcctgagtgctctgagcctcgatgagccatttatacagaaagatgtg
gaattaagaataatgcctccagttcaggaaaatgacaatgggaatgaaacagaatcagag
cagcctaaagaatcaaatgaaaaccaagagaaagaggcagaaaaaactattgattctgaa
aaggacctattagatgattcagatgatgatgatattgaaatactagaagaatgtattatt
tctgccatgccaacaaagtcatcacgtaaagcaaaaaagccagcccagactgcttcaaaa
ttacctccacctgtggcaaggaaaccaagtcagctgcctgtgtacaaacttctaccatca
caaaacaggttgcaaccccaaaagcatgttagttttacaccgggggatgatatgccacgg
gtgtattgtgttgaagggacacctataaacttttccacagctacatctctaagtgatcta
acaatcgaatcccctccaaatgagttagctgctggagaaggagttagaggaggggcacag
tcaggtgaatttgaaaaacgagataccattcctacagaaggcagaagtacagatgaggct
caaggaggaaaaacctcatctgtaaccatacctgaattggatgacaataaagcagaggaa
ggtgatattcttgcagaatgcattaattctgctatgcccaaagggaaaagtcacaagcct
ttccgtgtgaaaaagataatggaccaggtccagcaagcatctgcgtcttcttctgcaccc
aacaaaaatcagttagatggtaagaaaaagaaaccaacttcaccagtaaaacctatacca
caaaatactgaatataggacacgtgtaagaaaaaatgcagactcaaaaaataatttaaat
gctgagagagttttctcagacaacaaagattcaaagaaacagaatttgaaaaataattcc
aaggtcttcaatgataagctcccaaataatgaagatagagtcagaggaagttttgctttt
gattcacctcatcattacacgcctattgaaggaactccttactgtttttcacgaaatgat
tctttgagttctctagattttgatgatgatgatgttgacctttccagggaaaaggctgaa
ttaagaaaggcaaaagaaaataaggaatcagaggctaaagttaccagccacacagaacta
acctccaaccaacaatcagctaataagacacaagctattgcaaagcagccaataaatcga
ggtcagcctaaacccatacttcagaaacaatccacttttccccagtcatccaaagacata
ccagacagaggggcagcaactgatgaaaagttacagaattttgctattgaaaatactccg
gtttgcttttctcataattcctctctgagttctctcagtgacattgaccaagaaaacaac
aataaagaaaatgaacctatcaaagagactgagccccctgactcacagggagaaccaagt
aaacctcaagcatcaggctatgctcctaaatcatttcatgttgaagataccccagtttgt
ttctcaagaaacagttctctcagttctcttagtattgactctgaagatgacctgttgcag
gaatgtataagctccgcaatgccaaaaaagaaaaagccttcaagactcaagggtgataat
gaaaaacatagtcccagaaatatgggtggcatattaggtgaagatctgacacttgatttg
aaagatatacagagaccagattcagaacatggtctatcccctgattcagaaaattttgat
tggaaagctattcaggaaggtgcaaattccatagtaagtagtttacatcaagctgctgct
gctgcatgtttatctagacaagcttcgtctgattcagattccatcctttccctgaaatca
ggaatctctctgggatcaccatttcatcttacacctgatcaagaagaaaaaccctttaca
agtaataaaggcccacgaattctaaaaccaggggagaaaagtacattggaaactaaaaag
atagaatctgaaagtaaaggaatcaaaggaggaaaaaaagtttataaaagtttgattact
ggaaaagttcgatctaattcagaaatttcaggccaaatgaaacagccccttcaagcaaac
atgccttcaatctctcgaggcaggacaatgattcatattccaggagttcgaaatagctcc
tcaagtacaagtcctgtttctaaaaaaggcccaccccttaagactccagcctccaaaagc
cctagtgaaggtcaaacagccaccacttctcctagaggagccaagccatctgtgaaatca
gaattaagccctgttgccaggcagacatcccaaataggtgggtcaagtaaagcaccttct
agatcaggatctagagattcgaccccttcaagacctgcccagcaaccattaagtagacct
atacagtctcctggccgaaactcaatttcccctggtagaaatggaataagtcctcctaac
aaattatctcaacttccaaggacatcatcccctagtactgcttcaactaagtcctcaggt
tctggaaaaatgtcatatacatctccaggtagacagatgagccaacagaaccttaccaaa
caaacaggtttatccaagaatgccagtagtattccaagaagtgagtctgcctccaaagga
ctaaatcagatgaataatggtaatggagccaataaaaaggtagaactttctagaatgtct
tcaactaaatcaagtggaagtgaatctgatagatcagaaagacctgtattagtacgccag
tcaactttcatcaaagaagctccaagcccaaccttaagaagaaaattggaggaatctgct
tcatttgaatctctttctccatcatctagaccagcttctcccactaggtcccaggcacaa
actccagttttaagtccttcccttcctgatatgtctctatccacacattcgtctgttcag
gctggtggatggcgaaaactcccacctaatctcagtcccactatagagtataatgatgga
agaccagcaaagcgccatgatattgcacggtctcattctgaaagtccttctagacttcca
atcaataggtcaggaacctggaaacgtgagcacagcaaacattcatcatcccttcctcga
gtaagcacttggagaagaactggaagttcatcttcaattctttctgcttcatcagaatcc
agtgaaaaagcaaaaagtgaggatgaaaaacatgtgaactctatttcaggaaccaaacaa
agtaaagaaaaccaagtatccgcaaaaggaacatggagaaaaataaaagaaaatgaattt
tctcccacaaatagtacttctcagaccgtttcctcaggtgctacaaatggtgctgaatca
aagactctaatttatcaaatggcacctgctgtttctaaaacagaggatgtttgggtgaga
attgaggactgtcccattaacaatcctagatctggaagatctcccacaggtaatactccc
ccggtgattgacagtgtttcagaaaaggcaaatccaaacattaaagattcaaaagataat
caggcaaaacaaaatgtgggtaatggcagtgttcccatgcgtaccgtgggtttggaaaat
cgcctgaactcctttattcaggtggatgcccctgaccaaaaaggaactgagataaaacca
ggacaaaataatcctgtccctgtatcagagactaatgaaagttctatagtggaacgtacc
ccattcagttctagcagctcaagcaaacacagttcacctagtgggactgttgctgccaga
gtgactccttttaattacaacccaagccctaggaaaagcagcgcagatagcacttcagct
cggccatctcagatcccaactccagtgaataacaacacaaagaagcgagattccaaaact
gacagcacagaatccagtggaacccaaagtcctaagcgccattctgggtcttaccttgtg
acatctgtttaa

DBGET integrated database retrieval system