KEGG   Homo sapiens (human): 3240Help
Entry
3240              CDS       T01001                                 

Gene name
HP, BP, HP2ALPHA2, HPA1S
Definition
(RefSeq) haptoglobin
  KO
K16142  haptoglobin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    3240 (HP)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3240 (HP)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   3240 (HP)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   3240 (HP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Sushi DUF1986
Motif
Other DBs
NCBI-GeneID: 3240
NCBI-ProteinID: NP_005134
OMIM: 140100
HGNC: 5141
Ensembl: ENSG00000257017
Vega: OTTHUMG00000173009
Pharos: P00738(Tbio)
UniProt: P00738 Q6PEJ8
Structure
PDB: 

Position
16q22.2
AA seq 406 aa AA seqDB search
MSALGAVIALLLWGQLFAVDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRT
EGDGVYTLNDKKQWINKAVGDKLPECEADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTE
GDGVYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMV
SHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHP
NYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYVM
LPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFA
VHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAEN
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagtgccctgggagctgtcattgccctcctgctctggggacagctttttgcagtggac
tcaggcaatgatgtcacggatatcgcagatgacggctgcccgaagccccccgagattgca
catggctatgtggagcactcggttcgctaccagtgtaagaactactacaaactgcgcaca
gaaggagatggagtatacaccttaaatgataagaagcagtggataaataaggctgttgga
gataaacttcctgaatgtgaagcagatgacggctgcccgaagccccccgagattgcacat
ggctatgtggagcactcggttcgctaccagtgtaagaactactacaaactgcgcacagaa
ggagatggagtgtacaccttaaacaatgagaagcagtggataaataaggctgttggagat
aaacttcctgaatgtgaagcagtatgtgggaagcccaagaatccggcaaacccagtgcag
cggatcctgggtggacacctggatgccaaaggcagctttccctggcaggctaagatggtt
tcccaccataatctcaccacaggtgccacgctgatcaatgaacaatggctgctgaccacg
gctaaaaatctcttcctgaaccattcagaaaatgcaacagcgaaagacattgcccctact
ttaacactctatgtggggaaaaagcagcttgtagagattgagaaggttgttctacaccct
aactactcccaggtagatattgggctcatcaaactcaaacagaaggtgtctgttaatgag
agagtgatgcccatctgcctaccttcaaaggattatgcagaagtagggcgtgtgggttat
gtttctggctgggggcgaaatgccaattttaaatttactgaccatctgaagtatgtcatg
ctgcctgtggctgaccaagaccaatgcataaggcattatgaaggcagcacagtccccgaa
aagaagacaccgaagagccctgtaggggtgcagcccatactgaatgaacacaccttctgt
gctggcatgtctaagtaccaagaagacacctgctatggcgatgcgggcagtgcctttgcc
gttcacgacctggaggaggacacctggtatgcgactgggatcttaagctttgataagagc
tgtgctgtggctgagtatggtgtgtatgtgaaggtgacttccatccaggactgggttcag
aagaccatagctgagaactaa

DBGET integrated database retrieval system