KEGG   Homo sapiens (human): 3250Help
Entry
3250              CDS       T01001                                 

Gene name
HPR, A-259H10.2, HP
Definition
(RefSeq) haptoglobin-related protein
  KO
K14477  haptoglobin-related protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05143  African trypanosomiasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09174 Infectious diseases: Parasitic
   05143 African trypanosomiasis
    3250 (HPR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin
Motif
Other DBs
NCBI-GeneID: 3250
NCBI-ProteinID: NP_066275
OMIM: 140210
HGNC: 5156
Ensembl: ENSG00000261701
Vega: OTTHUMG00000173010
Pharos: P00739(Tbio)
UniProt: P00739
Position
16q22.2
AA seq 348 aa AA seqDB search
MSDLGAVISLLLWGRQLFALYSGNDVTDISDDRFPKPPEIANGYVEHLFRYQCKNYYRLR
TEGDGVYTLNDKKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAK
MVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVL
HPNYHQVDIGLIKLKQKVLVNERVMPICLPSKNYAEVGRVGYVSGWGQSDNFKLTDHLKY
VMLPVADQYDCITHYEGSTCPKWKAPKSPVGVQPILNEHTFCVGMSKYQEDTCYGDAGSA
FAVHDLEEDTWYAAGILSFDKSCAVAEYGVYVKVTSIQHWVQKTIAEN
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacctgggagctgtcatttccctcctgctctggggacgacagctttttgcactg
tactcaggcaatgatgtcacggatatttcagatgaccgcttcccgaagccccctgagatt
gcaaatggctatgtggagcacttgtttcgctaccagtgtaagaactactacagactgcgc
acagaaggagatggagtatacaccttaaatgataagaagcagtggataaataaggctgtt
ggagataaacttcctgaatgtgaagcagtatgtgggaagcccaagaatccggcaaaccca
gtgcagcggatcctgggtggacacctggatgccaaaggcagctttccctggcaggctaag
atggtttcccaccataatctcaccacaggggccacgctgatcaatgaacaatggctgctg
accacggctaaaaatctcttcctgaaccattcagaaaatgcaacagcgaaagacattgcc
cctactttaacactctatgtggggaaaaagcagcttgtagagattgagaaggtggttcta
caccctaactaccaccaggtagatattgggctcatcaaactcaaacagaaggtgcttgtt
aatgagagagtgatgcccatctgcctaccttcaaagaattatgcagaagtagggcgtgtg
ggttacgtgtctggctggggacaaagtgacaactttaaacttactgaccatctgaagtat
gtcatgctgcctgtggctgaccaatacgattgcataacgcattatgaaggcagcacatgc
cccaaatggaaggcaccgaagagccctgtaggggtgcagcccatactgaacgaacacacc
ttctgtgtcggcatgtctaagtaccaggaagacacctgctatggcgatgcgggcagtgcc
tttgccgttcacgacctggaggaggacacctggtacgcggctgggatcctaagctttgat
aagagctgtgctgtggctgagtatggtgtgtatgtgaaggtgacttccatccagcactgg
gttcagaagaccatagctgagaactaa

DBGET integrated database retrieval system