KEGG   Homo sapiens (human): 3263
Entry
3263              CDS       T01001                                 
Symbol
HPX, HX
Name
(RefSeq) hemopexin
  KO
K18977  hemopexin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    3263 (HPX)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    3263 (HPX)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   3263 (HPX)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   3263 (HPX)
SSDB
Motif
Pfam: Hemopexin
Other DBs
NCBI-GeneID: 3263
NCBI-ProteinID: NP_000604
OMIM: 142290
HGNC: 5171
Ensembl: ENSG00000110169
Pharos: P02790(Tbio)
UniProt: P02790 Q9BS19
Position
11:complement(6431049..6440987)
AA seq 462 aa
MARVLGAPVALGLWSLCWSLAIATPLPPTSAHGNVAEGETKPDPDVTERCSDGWSFDATT
LDDNGTMLFFKGEFVWKSHKWDRELISERWKNFPSPVDAAFRQGHNSVFLIKGDKVWVYP
PEKKEKGYPKLLQDEFPGIPSPLDAAVECHRGECQAEGVLFFQGDREWFWDLATGTMKER
SWPAVGNCSSALRWLGRYYCFQGNQFLRFDPVRGEVPPRYPRDVRDYFMPCPGRGHGHRN
GTGHGNSTHHGPEYMRCSPHLVLSALTSDNHGATYAFSGTHYWRLDTSRDGWHSWPIAHQ
WPQGPSAVDAAFSWEEKLYLVQGTQVYVFLTKGGYTLVSGYPKRLEKEVGTPHGIILDSV
DAAFICPGSSRLHIMAGRRLWWLDLKSGAQATWTELPWPHEKVDGALCMEKSLGPNSCSA
NGPGLYLIHGPNLYCYSDVEKLNAAKALPQPQNVTSLLGCTH
NT seq 1389 nt   +upstreamnt  +downstreamnt
atggctagggtactgggagcacccgttgcactggggttgtggagcctatgctggtctctg
gccattgccacccctcttcctccgactagtgcccatgggaatgttgctgaaggcgagacc
aagccagacccagacgtgactgaacgctgctcagatggctggagctttgatgctaccacc
ctggatgacaatggaaccatgctgttttttaaaggggagtttgtgtggaagagtcacaaa
tgggaccgggagttaatctcagagagatggaagaatttccccagccctgtggatgctgca
ttccgtcaaggtcacaacagtgtctttctgatcaagggggacaaagtctgggtataccct
cctgaaaagaaggagaaaggatacccaaagttgctccaagatgaatttcctggaatccca
tccccactggatgcagctgtggaatgtcaccgtggagaatgtcaagctgaaggcgtcctc
ttcttccaaggtgaccgcgagtggttctgggacttggctacgggaaccatgaaggagcgt
tcctggccagctgttgggaactgctcctctgccctgagatggctgggccgctactactgc
ttccagggtaaccaattcctgcgcttcgaccctgtcaggggagaggtgcctcccaggtac
ccgcgggatgtccgagactacttcatgccctgccctggcagaggccatggacacaggaat
gggactggccatgggaacagtacccaccatggccctgagtatatgcgctgtagcccacat
ctagtcttgtctgcactgacgtctgacaaccatggtgccacctatgccttcagtgggacc
cactactggcgtctggacaccagccgggatggctggcatagctggcccattgctcatcag
tggccccagggtccttcagcagtggatgctgccttttcctgggaagaaaaactctatctg
gtccagggcacccaggtatatgtcttcctgacaaagggaggctataccctagtaagcggt
tatccgaagcggctggagaaggaagtcgggacccctcatgggattatcctggactctgtg
gatgcggcctttatctgccctgggtcttctcggctccatatcatggcaggacggcggctg
tggtggctggacctgaagtcaggagcccaagccacgtggacagagcttccttggccccat
gagaaggtagacggagccttgtgtatggaaaagtcccttggccctaactcatgttccgcc
aatggtcccggcttgtacctcatccatggtcccaatttgtactgctacagtgatgtggag
aaactgaatgcagccaaggcccttccgcaaccccagaatgtgaccagtctcctgggctgc
actcactga

DBGET integrated database retrieval system