KEGG   Homo sapiens (human): 3267Help
Entry
3267              CDS       T01001                                 

Gene name
AGFG1, HRB, RAB, RIP
Definition
(RefSeq) ArfGAP with FG repeats 1
  KO
K15044  Arf-GAP domain and FG repeats-containing protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    3267 (AGFG1)
   04131 Membrane trafficking [BR:hsa04131]
    3267 (AGFG1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Trans-acting binding proteins
     3267 (AGFG1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    3267 (AGFG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ArfGap
Motif
Other DBs
NCBI-GeneID: 3267
NCBI-ProteinID: NP_004495
OMIM: 600862
HGNC: 5175
Ensembl: ENSG00000173744
Vega: OTTHUMG00000133186
Pharos: P52594(Tbio)
UniProt: P52594 A0A0S2Z444
Structure
PDB: 

Position
2q36.3
AA seq 562 aa AA seqDB search
MAASAKRKQEEKHLKMLRDMTGLPHNRKCFDCDQRGPTYVNMTVGSFVCTSCSGSLRGLN
PPHRVKSISMTTFTQQEIEFLQKHGNEVCKQIWLGLFDDRSSAIPDFRDPQKVKEFLQEK
YEKKRWYVPPEQAKVVASVHASISGSSASSTSSTPEVKPLKSLLGDSAPTLHLNKGTPSQ
SPVVGRSQGQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFNSHAAQNSANADF
ANFDAFGQSSGSSNFGGFPTASHSPFQPQTTGGSAASVNANFAHFDNFPKSSSADFGTFN
TSQSHQTASAVSKVSTNKAGLQTADKYAALANLDNIFSAGQGGDQGSGFGTTGKAPVGSV
VSVPSQSSASSDKYAALAELDSVFSSAATSSNAYTSTSNASSNVFGTVPVVASAQTQPAS
SSVPAPFGATPSTNPFVAAAGPSVASSTNPFQTNARGATAATFGTASMSMPTGFGTPAPY
SLPTSFSGSFQQPAFPAQAAFPQQTAFSQQPNGAGFAAFGQTKPVVTPFGQVAAAGVSSN
PFMTGAPTGQFPTGSSSTNPFL
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggcggccagcgcgaagcggaagcaggaggagaagcacctgaagatgctgcgggacatg
accggcctcccgcacaaccgaaagtgcttcgactgcgaccagcgcggccccacctacgtt
aacatgacggtcggctccttcgtgtgtacctcctgctccggcagcctgcgaggattaaat
ccaccacacagggtgaaatctatctccatgacaacattcacacaacaggaaattgaattc
ttacaaaaacatggaaatgaagtctgtaaacagatttggctaggattatttgatgataga
tcttcagcaattccagacttcagggatccacaaaaagtgaaagagtttctacaagaaaag
tatgaaaagaaaagatggtatgtcccgccagaacaagccaaagtcgtggcatcagttcat
gcatctatttcagggtcctctgccagtagcacaagcagcacacctgaggtcaaaccactg
aaatctcttttaggggattctgcaccaacactgcacttaaataagggcacacctagtcag
tccccagttgtaggtcgttctcaagggcagcagcaggagaagaagcaatttgacctttta
agtgatctcggctcagacatctttgctgctccagctcctcagtcaacagctacagccaat
tttgctaactttgcacatttcaacagtcatgcagctcagaattctgcaaatgcagatttt
gcaaactttgatgcatttggacagtctagtggttcgagtaattttggaggtttccccaca
gcaagtcactctccttttcagccccaaactacaggtggaagtgctgcatcagtaaatgct
aattttgctcattttgataacttccccaaatcctccagtgctgattttggaaccttcaat
acttcccagagtcatcaaacagcatcagctgttagtaaagtttcaacgaacaaagctggt
ttacagactgcagacaaatatgcagcacttgctaatttagacaatatcttcagtgccggg
caaggtggtgatcagggaagtggctttgggaccacaggtaaagctcctgttggttctgtg
gtttcagttcccagtcagtcaagtgcatcttcagacaagtatgcagctctggcagaacta
gacagcgttttcagttctgcagccacctccagtaatgcgtatacttccacaagtaatgct
agcagcaatgtttttggaacagtgccagtggttgcttctgcacagacacagcctgcttca
tcaagtgtgcctgctccatttggagctacgccttccacaaatccatttgttgctgctgct
ggtccttctgtggcatcttctacaaacccatttcagaccaatgccagaggagcaacagcg
gcaacctttggcactgcatccatgagcatgcccacaggattcggcactcctgctccctac
agtcttcccaccagctttagtggcagctttcagcagcctgcctttccagcccaagcagct
ttccctcaacagacagctttttctcaacagcccaatggtgcaggttttgcagcatttgga
caaacaaagccagtagtaaccccttttggtcaagttgcagctgctggagtatctagtaat
ccttttatgactggtgcaccaacaggacaatttccaacaggaagctcatcaaccaatcct
ttcttatag

DBGET integrated database retrieval system