KEGG   Homo sapiens (human): 3273Help
Entry
3273              CDS       T01001                                 

Gene name
HRG, HPRG, HRGP, THPH11
Definition
(RefSeq) histidine rich glycoprotein
  KO
K23410  histidine-rich glycoprotein
Organism
hsa  Homo sapiens (human)
Disease
H00223  Inherited thrombophilia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    3273 (HRG)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I25: cystatin family
   3273 (HRG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cystatin Cathelicidins
Motif
Other DBs
NCBI-GeneID: 3273
NCBI-ProteinID: NP_000403
OMIM: 142640
HGNC: 5181
Ensembl: ENSG00000113905
Vega: OTTHUMG00000156578
Pharos: P04196(Tbio)
UniProt: P04196
Position
3q27.3
AA seq 525 aa AA seqDB search
MKALIAALLLITLQYSCAVSPTDCSAVEPEAEKALDLINKRRRDGYLFQLLRIADAHLDR
VENTTVYYLVLDVQESDCSVLSRKYWNDCEPPDSRRPSEIVIGQCKVIATRHSHESQDLR
VIDFNCTTSSVSSALANTKDSPVLIDFFEDTERYRKQANKALEKYKEENDDFASFRVDRI
ERVARVRGGEGTGYFVDFSVRNCPRHHFPRHPNVFGFCRADLFYDVEALDLESPKNLVIN
CEVFDPQEHENINGVPPHLGHPFHWGGHERSSTTKPPFKPHGSRDHHHPHKPHEHGPPPP
PDERDHSHGPPLPQGPPPLLPMSCSSCQHATFGTNGAQRHSHNNNSSDLHPHKHHSHEQH
PHGHHPHAHHPHEHDTHRQHPHGHHPHGHHPHGHHPHGHHPHGHHPHCHDFQDYGPCDPP
PHNQGHCCHGHGPPPGHLRRRGPGKGPRPFHCRQIGSVYRLPPLRKGEVLPLPEANFPSF
PLPHHKHPLKPDNQPFPQSVSESCPGKFKSGFPQVSMFFTHTFPK
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcactcattgcagcactgcttttgatcacattgcagtattcgtgtgccgtgagt
cccactgactgcagtgctgttgagccggaggctgagaaagctctagacctgatcaataaa
aggcgacgggatggctaccttttccaattgctgcggattgctgatgcccacttggacaga
gtggaaaatacaactgtatattacttagtcttagatgtgcaagaatcggactgttcggtc
ctatccaggaaatactggaatgactgtgagccacctgattccagacgtccatctgaaata
gtgatcggacaatgtaaggtaatagctacaagacattcccatgaatctcaggacctcaga
gtgattgactttaactgcaccacaagttctgtctcttcagcactggccaataccaaagat
agtccggtcctcatagatttctttgaggatactgagcgctacagaaaacaagccaacaaa
gcccttgagaagtacaaagaggagaatgatgactttgcctctttcagagtggaccgaatc
gagagagttgcaagagtgagaggaggggaaggaactggttacttcgtggacttctctgtg
cggaactgccccagacaccatttccccagacaccccaatgtctttggattctgcagagca
gatttgttctatgatgtagaagccttggacttggaaagcccgaaaaaccttgtcataaac
tgtgaagtcttcgaccctcaggaacatgagaacatcaatggtgtaccgcctcatttggga
catcccttccactggggtgggcatgagcgttcttctaccaccaagcctccattcaagccc
catggatctagagatcatcatcatccccacaagccacacgaacatggacccccacctcct
ccagatgaaagagatcactcacatggacccccacttccacaaggccctcctccactattg
cccatgtcctgctcaagttgtcaacatgccacttttggcacaaatggggcccaaagacat
tctcataataataattccagtgacctccatccccataagcatcattcccatgaacagcat
ccccacggacaccatccccatgcacaccatcctcatgaacatgatacccatagacagcat
ccccatggacaccacccccatggacaccatcctcatggacaccacccccatggacaccat
ccccatggacaccatccccactgccatgatttccaagactatggaccttgtgacccacca
ccccataaccaaggtcactgttgccatggccacggcccaccacctgggcacttaagaagg
cgaggcccaggtaaaggaccccgtcccttccattgcagacaaattggatctgtgtaccga
ctccctcctctaagaaaaggtgaggtgctgccacttcctgaggccaattttcccagcttc
ccattgccgcaccacaaacatcctctaaagccagacaatcagccctttcctcaatcagtc
tctgaatcatgtccagggaagttcaagagtgggtttccacaagtttccatgttttttaca
catacatttccaaaataa

DBGET integrated database retrieval system