KEGG   Homo sapiens (human): 3274Help
Entry
3274              CDS       T01001                                 

Gene name
HRH2, H2R
Definition
(RefSeq) histamine receptor H2
  KO
K04150  histamine receptor H2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04971  Gastric acid secretion
Drug target
Betazole: D01187
Cimetidine (DG00017): D00295 D03503
Dalcotidine: D01698
Donetidine: D03889
Etintidine hydrochloride: D04098
Famotidine: D00318
Histamine: D08040
Histamine phosphate: D04445
Icotidine: D04494
Impromidine hydrochloride: D04517
Lafutidine: D01131
Lavoltidine succinate: D04680
Lupitidine hydrochloride: D04794
Methantheline (DG00036): D00721
Metiamide: D05004
Niperotidine: D07072
Nizatidine: D00440
Osutidine: D01193
Oxmetidine (DG01225): D05306 D05307
Pibutidine hydrochloride: D01861
Ranitidine (DG00018): D00422 D00673
Ranitidine bismuth citrate: D05699
Roxatidine (DG00019): D01467 D08494 D08495
Sufotidine: D05939
Tiotidine: D06157
Zaltidine hydrochloride: D06355
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    3274 (HRH2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3274 (HRH2)
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    3274 (HRH2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3274 (HRH2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Histamine
    3274 (HRH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Motif
Other DBs
NCBI-GeneID: 3274
NCBI-ProteinID: NP_001124527
OMIM: 142703
HGNC: 5183
Ensembl: ENSG00000113749
Vega: OTTHUMG00000130660
Pharos: P25021(Tclin)
UniProt: P25021
Position
5q35.2
AA seq 397 aa AA seqDB search
MAPNGTASSFCLDSTACKITITVVLAVLILITVAGNVVVCLAVGLNRRLRNLTNCFIVSL
AITDLLLGLLVLPFSAIYQLSCKWSFGKVFCNIYTSLDVMLCTASILNLFMISLDRYCAV
MDPLRYPVLVTPVRVAISLVLIWVISITLSFLSIHLGWNSRNETSKGNHTTSKCKVQVNE
VYGLVDGLVTFYLPLLIMCITYYRIFKVARDQAKRINHISSWKAATIREHKATVTLAAVM
GAFIICWFPYFTAFVYRGLRGDDAINEVLEAIVLWLGYANSALNPILYAALNRDFRTGYQ
QLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDRP
WLCLPECWSVELTHSFIHLFIHSFANIHPIPTTCQEL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcacccaatggcacagcctcttccttttgcctggactctaccgcatgcaagatcacc
atcaccgtggtccttgcggtcctcatcctcatcaccgttgctggcaatgtggtcgtctgt
ctggccgtgggcttgaaccgccggctccgcaacctgaccaattgtttcatcgtgtccttg
gctatcactgacctgctcctcggcctcctggtgctgcccttctctgccatctaccagctg
tcctgcaagtggagctttggcaaggtcttctgcaatatctacaccagcctggatgtgatg
ctctgcacagcctccattcttaacctcttcatgatcagcctcgaccggtactgcgctgtc
atggacccactgcggtaccctgtgctggtcaccccagttcgggtcgccatctctctggtc
ttaatttgggtcatctccattaccctgtcctttctgtctatccacctggggtggaacagc
aggaacgagaccagcaagggcaatcataccacctctaagtgcaaagtccaggtcaatgaa
gtgtacgggctggtggatgggctggtcaccttctacctcccgctactgatcatgtgcatc
acctactaccgcatcttcaaggtcgcccgggatcaggccaagaggatcaatcacattagc
tcctggaaggcagccaccatcagggagcacaaagccacagtgacactggccgccgtcatg
ggggccttcatcatctgctggtttccctacttcaccgcgtttgtgtaccgtgggctgaga
ggggatgatgccatcaatgaggtgttagaagccatcgttctgtggctgggctatgccaac
tcagccctgaaccccatcctgtatgctgcgctgaacagagacttccgcaccgggtaccaa
cagctcttctgctgcaggctggccaaccgcaactcccacaaaacttctctgaggtccaac
gcctctcagctgtccaggacccaaagccgagaacccaggcaacaggaagagaaacccctg
aagctccaggtgtggagtgggacagaagtcacggccccccagggagccacagacagacca
tggctttgccttccagaatgctggtctgtggaactgacccattcattcattcatttgttc
attcattcatttgcaaacattcatccaattcccaccacatgccaggaattatga

DBGET integrated database retrieval system