KEGG   Homo sapiens (human): 328Help
Entry
328               CDS       T01001                                 

Gene name
APEX1, APE, APE1, APEN, APEX, APX, HAP1, REF1
Definition
(RefSeq) apurinic/apyrimidinic endodeoxyribonuclease 1
  KO
K10771  AP endonuclease 1 [EC:4.2.99.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    328 (APEX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    328 (APEX1)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     328 (APEX1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     328 (APEX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Exo_endo_phos Exo_endo_phos_2
Motif
Other DBs
NCBI-GeneID: 328
NCBI-ProteinID: NP_001231178
OMIM: 107748
HGNC: 587
Ensembl: ENSG00000100823
Vega: OTTHUMG00000029544
Pharos: P27695(Tchem)
UniProt: P27695 Q5TZP7
Structure
PDB: 

Position
14q11.2
AA seq 318 aa AA seqDB search
MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPA
TLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWS
APSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLV
RLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGF
GELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKI
RSKALGSDHCPITLYLAL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgccgaagcgtgggaaaaagggagcggtggcggaagacggggatgagctcaggacagag
ccagaggccaagaagagtaagacggccgcaaagaaaaatgacaaagaggcagcaggagag
ggcccagccctgtatgaggaccccccagatcagaaaacctcacccagtggcaaacctgcc
acactcaagatctgctcttggaatgtggatgggcttcgagcctggattaagaagaaagga
ttagattgggtaaaggaagaagccccagatatactgtgccttcaagagaccaaatgttca
gagaacaaactaccagctgaacttcaggagctgcctggactctctcatcaatactggtca
gctccttcggacaaggaagggtacagtggcgtgggcctgctttcccgccagtgcccactc
aaagtttcttacggcataggcgatgaggagcatgatcaggaaggccgggtgattgtggct
gaatttgactcgtttgtgctggtaacagcatatgtacctaatgcaggccgaggtctggta
cgactggagtaccggcagcgctgggatgaagcctttcgcaagttcctgaagggcctggct
tcccgaaagccccttgtgctgtgtggagacctcaatgtggcacatgaagaaattgacctt
cgcaaccccaaggggaacaaaaagaatgctggcttcacgccacaagagcgccaaggcttc
ggggaattactgcaggctgtgccactggctgacagctttaggcacctctaccccaacaca
ccctatgcctacaccttttggacttatatgatgaatgctcgatccaagaatgttggttgg
cgccttgattactttttgttgtcccactctctgttacctgcattgtgtgacagcaagatc
cgttccaaggccctcggcagtgatcactgtcctatcaccctatacctagcactgtga

DBGET integrated database retrieval system