KEGG   Homo sapiens (human): 3280Help
Entry
3280              CDS       T01001                                 

Gene name
HES1, HES-1, HHL, HRY, bHLHb39
Definition
(RefSeq) hes family bHLH transcription factor 1
  KO
K06054  hairy and enhancer of split 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03460  Fanconi anemia pathway
hsa04330  Notch signaling pathway
hsa04950  Maturity onset diabetes of the young
hsa05165  Human papillomavirus infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05224  Breast cancer
Network
N00086  Notch signaling pathway
N00087  NOTCH-overexpression to Notch signaling pathway
N00225  EBV EBNA2 to RBP-Jk-mediated transcription
N00380  HPV E6 to Notch signaling pathway
N00381  HPV E6 to Notch signaling pathway
N00382  HPV E6 to Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    3280 (HES1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    3280 (HES1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    3280 (HES1)
  09162 Cancers: Specific types
   05224 Breast cancer
    3280 (HES1)
  09167 Endocrine and metabolic diseases
   04950 Maturity onset diabetes of the young
    3280 (HES1)
  09172 Infectious diseases: Viral
   05169 Epstein-Barr virus infection
    3280 (HES1)
   05165 Human papillomavirus infection
    3280 (HES1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3280 (HES1)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    3280 (HES1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    3280 (HES1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FA core complex binding factors
     3280 (HES1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hairy_orange HLH
Motif
Other DBs
NCBI-GeneID: 3280
NCBI-ProteinID: NP_005515
OMIM: 139605
HGNC: 5192
Ensembl: ENSG00000114315
Vega: OTTHUMG00000155984
Pharos: Q14469(Tbio)
UniProt: Q14469
Structure
PDB: 

Position
3q29
AA seq 280 aa AA seqDB search
MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTL
ILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNE
VTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAP
FAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAH
SGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgccagctgatataatggagaaaaattcctcgtccccggtggctgctaccccagccagt
gtcaacacgacaccggataaaccaaagacagcatctgagcacagaaagtcatcaaagcct
attatggagaaaagacgaagagcaagaataaatgaaagtctgagccagctgaaaacactg
attttggatgctctgaagaaagatagctcgcggcattccaagctggagaaggcggacatt
ctggaaatgacagtgaagcacctccggaacctgcagcgggcgcagatgacggctgcgctg
agcacagacccaagtgtgctggggaagtaccgagccggcttcagcgagtgcatgaacgag
gtgacccgcttcctgtccacgtgcgagggcgttaataccgaggtgcgcactcggctgctc
ggccacctggccaactgcatgacccagatcaatgccatgacctaccccgggcagccgcac
cccgccttgcaggcgccgccaccgcccccaccgggacccggcggcccccagcacgcgccg
ttcgcgccgccgccgccactcgtgcccatccccgggggcgcggcgccccctcccggcggc
gccccctgcaagctgggcagccaggctggagaggcggctaaggtgtttggaggcttccag
gtggtaccggctcccgatggccagtttgctttcctcattcccaacggggccttcgcgcac
agcggccctgtcatccccgtctacaccagcaacagcggcacctccgtgggccccaacgca
gtgtcaccttccagcggcccctcgcttacggcggactccatgtggaggccgtggcggaac
tga

DBGET integrated database retrieval system