KEGG   Homo sapiens (human): 3290Help
Entry
3290              CDS       T01001                                 

Gene name
HSD11B1, 11-DH, 11-beta-HSD1, CORTRD2, HDL, HSD11, HSD11B, HSD11L, SDR26C1
Definition
(RefSeq) hydroxysteroid 11-beta dehydrogenase 1
  KO
K15680  corticosteroid 11-beta-dehydrogenase isozyme 1 [EC:1.1.1.146]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00140  Steroid hormone biosynthesis
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Module
hsa_M00109  C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Network
N00309  Cortisone reduction
N00310  Mutation-inactivated HED11B1 to cortisone reduction
N00338  Cortisol biosynthesis
Disease
H01111  Cortisone reductase deficiency (CRD)
Drug target
Ammonium glycyrrhizate: D04987
Carbenoxolone (DG00024): D01899 D07615
Diammonium glycyrrhizinate: D02028
Dipotassium glycyrrhizinate: D02264
Enoxolone: D00156
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    3290 (HSD11B1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    3290 (HSD11B1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    3290 (HSD11B1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.146  11beta-hydroxysteroid dehydrogenase
     3290 (HSD11B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR THF_DHG_CYH_C DUF1776 Pyr_redox_3 Shikimate_DH 2-Hacid_dh_C Pyr_redox_2 NAD_binding_2 ApbA AdoHcyase_NAD
Motif
Other DBs
NCBI-GeneID: 3290
NCBI-ProteinID: NP_001193670
OMIM: 600713
HGNC: 5208
Ensembl: ENSG00000117594
Vega: OTTHUMG00000036481
Pharos: P28845(Tclin)
UniProt: P28845 X5D2L1
Structure
PDB: 

Position
1q32.2
AA seq 292 aa AA seqDB search
MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAH
VVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNH
ITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMV
AAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEE
CALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggcttttatgaaaaaatatctcctccccattctggggctcttcatggcctactactac
tattctgcaaacgaggaattcagaccagagatgctccaaggaaagaaagtgattgtcaca
ggggccagcaaagggatcggaagagagatggcttatcatctggcgaagatgggagcccat
gtggtggtgacagcgaggtcaaaagaaactctacagaaggtggtatcccactgcctggag
cttggagcagcctcagcacactacattgctggcaccatggaagacatgaccttcgcagag
caatttgttgcccaagcaggaaagctcatgggaggactagacatgctcattctcaaccac
atcaccaacacttctttgaatctttttcatgatgatattcaccatgtgcgcaaaagcatg
gaagtcaacttcctcagttacgtggtcctgactgtagctgccttgcccatgctgaagcag
agcaatggaagcattgttgtcgtctcctctctggctgggaaagtggcttatccaatggtt
gctgcctattctgcaagcaagtttgctttggatgggttcttctcctccatcagaaaggaa
tattcagtgtccagggtcaatgtatcaatcactctctgtgttcttggcctcatagacaca
gaaacagccatgaaggcagtttctgggatagtccatatgcaagcagctccaaaggaggaa
tgtgccctggagatcatcaaagggggagctctgcgccaagaagaagtgtattatgacagc
tcactctggaccactcttctgatcagaaatccatgcaggaagatcctggaatttctctac
tcaacgagctataatatggacagattcataaacaagtag

DBGET integrated database retrieval system