KEGG   Homo sapiens (human): 3290Help
Entry
3290              CDS       T01001                                 

Gene name
HSD11B1, 11-DH, 11-beta-HSD1, CORTRD2, HDL, HSD11, HSD11B, HSD11L, SDR26C1
Definition
(RefSeq) hydroxysteroid 11-beta dehydrogenase 1
  KO
K15680  corticosteroid 11-beta-dehydrogenase isozyme 1 [EC:1.1.1.146]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00140  Steroid hormone biosynthesis
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Module
hsa_M00109  C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Network
N00309  Cortisone reduction
N00310  Mutation-inactivated HED11B1 to cortisone reduction
N00338  Cortisol biosynthesis
Disease
H01111  Cortisone reductase deficiency
Drug target
Ammonium glycyrrhizate: D04987
Carbenoxolone (DG00024): D01899 D07615
Diammonium glycyrrhizinate: D02028
Dipotassium glycyrrhizinate: D02264
Enoxolone: D00156
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    3290 (HSD11B1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    3290 (HSD11B1)
 09160 Human Diseases
  09161 Cancers: Overview
   05204 Chemical carcinogenesis
    3290 (HSD11B1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.146  11beta-hydroxysteroid dehydrogenase
     3290 (HSD11B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR DUF1776 THF_DHG_CYH_C Shikimate_DH Pyr_redox_3 NAD_binding_2 2-Hacid_dh_C Pyr_redox_2 ApbA AdoHcyase_NAD
Motif
Other DBs
NCBI-GeneID: 3290
NCBI-ProteinID: NP_001193670
OMIM: 600713
HGNC: 5208
Ensembl: ENSG00000117594
Vega: OTTHUMG00000036481
Pharos: P28845(Tclin)
UniProt: P28845 X5D2L1
Structure
PDB: 

Position
1q32.2
AA seq 292 aa AA seqDB search
MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAH
VVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNH
ITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMV
AAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEE
CALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggcttttatgaaaaaatatctcctccccattctggggctcttcatggcctactactac
tattctgcaaacgaggaattcagaccagagatgctccaaggaaagaaagtgattgtcaca
ggggccagcaaagggatcggaagagagatggcttatcatctggcgaagatgggagcccat
gtggtggtgacagcgaggtcaaaagaaactctacagaaggtggtatcccactgcctggag
cttggagcagcctcagcacactacattgctggcaccatggaagacatgaccttcgcagag
caatttgttgcccaagcaggaaagctcatgggaggactagacatgctcattctcaaccac
atcaccaacacttctttgaatctttttcatgatgatattcaccatgtgcgcaaaagcatg
gaagtcaacttcctcagttacgtggtcctgactgtagctgccttgcccatgctgaagcag
agcaatggaagcattgttgtcgtctcctctctggctgggaaagtggcttatccaatggtt
gctgcctattctgcaagcaagtttgctttggatgggttcttctcctccatcagaaaggaa
tattcagtgtccagggtcaatgtatcaatcactctctgtgttcttggcctcatagacaca
gaaacagccatgaaggcagtttctgggatagtccatatgcaagcagctccaaaggaggaa
tgtgccctggagatcatcaaagggggagctctgcgccaagaagaagtgtattatgacagc
tcactctggaccactcttctgatcagaaatccatgcaggaagatcctggaatttctctac
tcaacgagctataatatggacagattcataaacaagtag

DBGET integrated database retrieval system