KEGG   Homo sapiens (human): 3291Help
Entry
3291              CDS       T01001                                 

Gene name
HSD11B2, AME, AME1, HSD11K, HSD2, SDR9C3
Definition
(RefSeq) hydroxysteroid 11-beta dehydrogenase 2
  KO
K00071  corticosteroid 11-beta-dehydrogenase isozyme 2 [EC:1.1.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00140  Steroid hormone biosynthesis
hsa01100  Metabolic pathways
hsa04960  Aldosterone-regulated sodium reabsorption
Module
hsa_M00109  C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Network
nt06019  Steroid hormone biosynthesis
  Element
N00338  Steroid hormone biosynthesis, progesterone to cortisol/cortisone
N00760  CYP11B1 deficiency in steroid hormone biosynthesis
N00761  CYP21A2 deficiency in steroid hormone biosynthesis
N00762  CYP17A1 deficiency in steroid hormone biosynthesis
N00773  HSD11B2 deficiency in steroid hormone biosynthesis
Disease
H00259  Apparent mineralocorticoid excess syndrome
H01633  High blood pressure
H01709  Glucocorticoid-induced osteonecrosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    3291 (HSD11B2)
 09150 Organismal Systems
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    3291 (HSD11B2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     3291 (HSD11B2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 DUF1776
Motif
Other DBs
NCBI-GeneID: 3291
NCBI-ProteinID: NP_000187
OMIM: 614232
HGNC: 5209
Ensembl: ENSG00000176387
Vega: OTTHUMG00000137507
Pharos: P80365(Tchem)
UniProt: P80365
Position
16q22.1
AA seq 405 aa AA seqDB search
MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALAV
LAAAGWIALSRLARPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPG
AIELRTCCSPRLRLLQMDLTKPGDISRVLEFTKAHTTSTGLWGLVNNAGHNEVVADAELS
PVATFRSCMEVNFFGALELTKGLLPLLRSSRGRIVTVGSPAGDMPYPCLGAYGTSKAAVA
LLMDTFSCELLPWGVKVSIIQPGCFKTESVRNVGQWEKRKQLLLANLPQELLQAYGKDYI
EHLHGQFLHSLRLAMSDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRR
RFLQAFFISHCLPRALQPGQPGTTPPQDAAQDPNLSPGPSPAVAR
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggagcgctggccttggccgtcgggcggcgcctggctgctcgtggctgcccgcgcgctg
ctgcagctgctgcgctcagacctgcgtctgggccgcccgctgctggcggcgctggcgctg
ctggccgcgctcgactggctgtgccagcgcctgctgcccccgccggccgcactcgccgtg
ctggccgccgccggctggatcgcgttgtcccgcctggcgcgcccgcagcgcctgccggtg
gccactcgcgcggtgctcatcaccggctgtgactctggttttggcaaggagacggccaag
aaactggactccatgggcttcacggtgctggccaccgtattggagttgaacagccccggt
gccatcgagctgcgtacctgctgctcccctcgcctaaggctgctgcagatggacctgacc
aaaccaggagacattagccgcgtgctagagttcaccaaggcccacaccaccagcaccggc
ctgtggggcctcgtcaacaacgcaggccacaatgaagtagttgctgatgcggagctgtct
ccagtggccactttccgtagctgcatggaggtgaatttctttggcgcgctcgagctgacc
aagggcctcctgcccctgctgcgcagctcaaggggccgcatcgtgactgtggggagccca
gcgggggacatgccatatccgtgcttgggggcctatggaacctccaaagcggccgtggcg
ctactcatggacacattcagctgtgaactccttccctggggggtcaaggtcagcatcatc
cagcctggctgcttcaagacagagtcagtgagaaacgtgggtcagtgggaaaagcgcaag
caattgctgctggccaacctgcctcaagagctgctgcaggcctacggcaaggactacatc
gagcacttgcatgggcagttcctgcactcgctacgcctggccatgtccgacctcacccca
gttgtagatgccatcacagatgcgctgctggcagctcggccccgccgccgctattacccc
ggccagggcctggggctcatgtacttcatccactactacctgcctgaaggcctgcggcgc
cgcttcctgcaggccttcttcatcagtcactgtctgcctcgagcactgcagcctggccag
cctggcactaccccaccacaggacgcagcccaggacccaaacctgagccccggcccttcc
ccagcagtggctcggtga

DBGET integrated database retrieval system