KEGG   Homo sapiens (human): 3292Help
Entry
3292              CDS       T01001                                 

Gene name
HSD17B1, 17-beta-HSD, 20-alpha-HSD, E2DH, EDH17B2, EDHB17, HSD17, SDR28C1
Definition
(RefSeq) hydroxysteroid 17-beta dehydrogenase 1
  KO
K00044  17beta-estradiol 17-dehydrogenase [EC:1.1.1.62]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00140  Steroid hormone biosynthesis
hsa01100  Metabolic pathways
hsa04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    3292 (HSD17B1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    3292 (HSD17B1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     3292 (HSD17B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase DUF1776 GDP_Man_Dehyd Eno-Rase_NADH_b
Motif
Other DBs
NCBI-GeneID: 3292
NCBI-ProteinID: NP_000404
OMIM: 109684
HGNC: 5210
Ensembl: ENSG00000108786
Vega: OTTHUMG00000180243
Pharos: P14061(Tchem)
UniProt: P14061
Structure
PDB: 

Position
17q21.2
AA seq 328 aa AA seqDB search
MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAARALACPPGSL
ETLQLDVRDSKSVAAARERVTEGRVDVLVCNAGLGLLGPLEALGEDAVASVLDVNVVGTV
RMLQAFLPDMKRRGSGRVLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVH
LSLIECGPVHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEV
FLTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNYVTAMHREVFGDVPAKAEAGAEAGG
GAGPGAEDEAGRGAVGDPELGDPPAAPQ
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcaccgtggtgctcatcaccggctgttcctcgggcatcggcctgcacttggcc
gtacgtctggcttcagatccatcccagagcttcaaagtgtatgccacgttgagggacctg
aaaacacagggccggctgtgggaggcggcccgggccctggcatgccctccgggatccctg
gagacgttgcagctggacgtaagggactcaaaatccgtggccgctgcccgggaacgcgtg
actgagggccgcgtggacgtgctggtgtgtaacgcaggcctgggcctgctggggccgctg
gaggcgctgggggaggacgccgtggcctctgtgctggacgtgaatgtagtagggactgtg
cggatgctgcaggccttcctgccagacatgaagaggcgcggttcgggacgcgtgttggtg
accgggagcgtgggaggattgatggggctgcctttcaatgacgtttattgcgccagcaag
ttcgcgctcgaaggcttatgcgagagtctggcggttctgctgctgccctttggggtccac
ttgagcctgatcgagtgcggcccagtgcacaccgccttcatggagaaggtgttgggcagc
ccagaggaggtgctggaccgcacggacatccacaccttccaccgcttctaccaatacctc
gcccacagcaagcaagtctttcgcgaggcggcgcagaaccctgaggaggtggcggaggtc
ttcctcaccgctttgcgcgccccgaagccgaccctgcgctacttcaccaccgagcgcttc
ctgcccctgctgcggatgcgcctggacgaccccagcggctccaactacgtcaccgccatg
caccgggaagtgttcggcgacgttccggcaaaggccgaggctggggccgaggctgggggc
ggggccgggcctggggcagaggacgaggccgggcgcggtgcggtgggggaccctgagctc
ggcgatcctccggccgccccgcagtaa

DBGET integrated database retrieval system