KEGG   Homo sapiens (human): 3301Help
Entry
3301              CDS       T01001                                 

Gene name
DNAJA1, DJ-2, DjA1, HDJ2, HSDJ, HSJ-2, HSJ2, HSPF4, NEDD7, hDJ-2
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member A1
  KO
K09502  DnaJ homolog subfamily A member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    3301 (DNAJA1)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP40 / DNAJ
   3301 (DNAJA1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Co-chaperones
    3301 (DNAJA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DnaJ_C DnaJ DnaJ_CXXCXGXG Anti-TRAP HypA
Motif
Other DBs
NCBI-GeneID: 3301
NCBI-ProteinID: NP_001530
OMIM: 602837
HGNC: 5229
Ensembl: ENSG00000086061
Vega: OTTHUMG00000019760
Pharos: P31689(Tchem)
UniProt: P31689
Structure
PDB: 

Position
9p21.1
AA seq 397 aa AA seqDB search
MVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDAKK
RELYDKGGEQAIKEGGAGGGFGSPMDIFDMFFGGGGRMQRERRGKNVVHQLSVTLEDLYN
GATRKLALQKNVICDKCEGRGGKKGAVECCPNCRGTGMQIRIHQIGPGMVQQIQSVCMEC
QGHGERISPKDRCKSCNGRKIVREKKILEVHIDKGMKDGQKITFHGEGDQEPGLEPGDII
IVLDQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVKHGDI
KCVLNEGMPIYRRPYEKGRLIIEFKVNFPENGFLSPDKLSLLEKLLPERKEVEETDEMDQ
VELVDFDPNQERRRHYNGEAYEDDEHHPRGGVQCQTS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaagaaacaacttactacgatgttttgggggtcaaacccaatgctactcaggaa
gaattgaaaaaggcttataggaaactggctttgaagtaccatcctgataagaacccaaat
gaaggagagaagtttaaacagatttctcaagcttacgaagttctctctgatgcaaagaaa
agggaattatatgacaaaggaggagaacaggcaattaaagagggtggagcaggtggcggt
tttggctcccccatggacatctttgatatgttttttggaggaggaggaaggatgcagaga
gaaaggagaggtaaaaatgttgtacatcagctctcagtaaccctagaagacttatataat
ggtgcaacaagaaaactggctctgcaaaagaatgtgatttgtgacaaatgtgaaggtaga
ggaggtaagaaaggagcagtagagtgctgtcccaattgccgaggtactggaatgcaaata
agaattcatcagataggacctggaatggttcagcaaattcagtctgtgtgcatggagtgc
cagggccatggggagcggatcagtcctaaagatagatgtaaaagctgcaacggaaggaag
atagttcgagagaagaaaattttagaagttcatattgacaaaggcatgaaagatggccag
aagataacattccatggtgaaggagaccaagaaccaggactggagccaggcgatattatc
attgtgttagatcagaaggaccatgctgtttttactcgacgaggagaagaccttttcatg
tgtatggacatacagctcgttgaagcactgtgtggcttccagaagccaatatctactctt
gacaaccgaaccatcgtcatcacctctcatccaggtcagattgtcaagcatggagatatc
aagtgtgtactaaatgaaggcatgccaatttatcgtagaccatatgaaaagggtcgccta
atcatcgaatttaaggtaaactttcctgagaatggctttctctctcctgataaactgtct
ttgctggaaaaactcctacccgagaggaaggaagtggaagagactgatgagatggaccaa
gtagaactggtggactttgatccaaatcaggaaagacggcgccactacaatggagaagca
tatgaggatgatgaacatcatcccagaggtggtgttcagtgtcagacctcttaa

DBGET integrated database retrieval system