KEGG   Homo sapiens (human): 3303Help
Entry
3303              CDS       T01001                                 

Gene name
HSPA1A, HEL-S-103, HSP70-1, HSP70-1A, HSP70.1, HSP70I, HSP72, HSPA1
Definition
(RefSeq) heat shock protein family A (Hsp70) member 1A
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa04010  MAPK signaling pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04144  Endocytosis
hsa04213  Longevity regulating pathway - multiple species
hsa04612  Antigen processing and presentation
hsa04915  Estrogen signaling pathway
hsa05020  Prion diseases
hsa05134  Legionellosis
hsa05145  Toxoplasmosis
hsa05162  Measles
hsa05164  Influenza A
hsa05169  Epstein-Barr virus infection
Module
hsa_M00353  Spliceosome, Prp19/CDC5L complex
hsa_M00355  Spliceosome, 35S U5-snRNP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    3303 (HSPA1A)
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    3303 (HSPA1A)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    3303 (HSPA1A)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    3303 (HSPA1A)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    3303 (HSPA1A)
  Endocrine system
   04915 Estrogen signaling pathway
    3303 (HSPA1A)
  Aging
   04213 Longevity regulating pathway - multiple species
    3303 (HSPA1A)
 Human Diseases
  Neurodegenerative diseases
   05020 Prion diseases
    3303 (HSPA1A)
  Infectious diseases
   05134 Legionellosis
    3303 (HSPA1A)
   05162 Measles
    3303 (HSPA1A)
   05164 Influenza A
    3303 (HSPA1A)
   05169 Epstein-Barr virus infection
    3303 (HSPA1A)
   05145 Toxoplasmosis
    3303 (HSPA1A)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     3303 (HSPA1A)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19 complex
    3303 (HSPA1A)
 Complex C
   Prp19-CDC5 complex
    3303 (HSPA1A)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    3303 (HSPA1A)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP70 / DNAK
   3303 (HSPA1A)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    3303 (HSPA1A)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    3303 (HSPA1A)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    3303 (HSPA1A)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    3303 (HSPA1A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3303 (HSPA1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Radial_spoke_3
Motif
Other DBs
NCBI-GeneID: 3303
NCBI-ProteinID: NP_005336
OMIM: 140550
HGNC: 5232
Ensembl: ENSG00000204389
Vega: OTTHUMG00000031201
UniProt: P0DMV8 P0DMV9 A8K5I0 B3KTT5
Structure
PDB: 

Position
6p21.33
AA seq 641 aa AA seqDB search
MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEIS
SMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAA
IAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNH
FVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRA
RFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLN
KSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTI
PTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDI
DANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKN
ALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELE
QVCNPIISGLYQGAGGPGPGGFGAQGPKGGSGSGPTIEEVD
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagccgcggcgatcggcatcgacctgggcaccacctactcctgcgtgggggtg
ttccaacacggcaaggtggagatcatcgccaacgaccagggcaaccgcaccacccccagc
tacgtggccttcacggacaccgagcggctcatcggggatgcggccaagaaccaggtggcg
ctgaacccgcagaacaccgtgtttgacgcgaagcggctgattggccgcaagttcggcgac
ccggtggtgcagtcggacatgaagcactggcctttccaggtgatcaacgacggagacaag
cccaaggtgcaggtgagctacaagggggagaccaaggcattctaccccgaggagatctcg
tccatggtgctgaccaagatgaaggagatcgccgaggcgtacctgggctacccggtgacc
aacgcggtgatcaccgtgccggcctacttcaacgactcgcagcgccaggccaccaaggat
gcgggtgtgatcgcggggctcaacgtgctgcggatcatcaacgagcccacggccgccgcc
atcgcctacggcctggacagaacgggcaagggggagcgcaacgtgctcatctttgacctg
ggcgggggcaccttcgacgtgtccatcctgacgatcgacgacggcatcttcgaggtgaag
gccacggccggggacacccacctgggtggggaggactttgacaacaggctggtgaaccac
ttcgtggaggagttcaagagaaaacacaagaaggacatcagccagaacaagcgagccgtg
aggcggctgcgcaccgcctgcgagagggccaagaggaccctgtcgtccagcacccaggcc
agcctggagatcgactccctgtttgagggcatcgacttctacacgtccatcaccagggcg
aggttcgaggagctgtgctccgacctgttccgaagcaccctggagcccgtggagaaggct
ctgcgcgacgccaagctggacaaggcccagattcacgacctggtcctggtcgggggctcc
acccgcatccccaaggtgcagaagctgctgcaggacttcttcaacgggcgcgacctgaac
aagagcatcaaccccgacgaggctgtggcctacggggcggcggtgcaggcggccatcctg
atgggggacaagtccgagaacgtgcaggacctgctgctgctggacgtggctcccctgtcg
ctggggctggagacggccggaggcgtgatgactgccctgatcaagcgcaactccaccatc
cccaccaagcagacgcagatcttcaccacctactccgacaaccaacccggggtgctgatc
caggtgtacgagggcgagagggccatgacgaaagacaacaatctgttggggcgcttcgag
ctgagcggcatccctccggcccccaggggcgtgccccagatcgaggtgaccttcgacatc
gatgccaacggcatcctgaacgtcacggccacggacaagagcaccggcaaggccaacaag
atcaccatcaccaacgacaagggccgcctgagcaaggaggagatcgagcgcatggtgcag
gaggcggagaagtacaaagcggaggacgaggtgcagcgcgagagggtgtcagccaagaac
gccctggagtcctacgccttcaacatgaagagcgccgtggaggatgaggggctcaagggc
aagatcagcgaggcggacaagaagaaggtgctggacaagtgtcaagaggtcatctcgtgg
ctggacgccaacaccttggccgagaaggacgagtttgagcacaagaggaaggagctggag
caggtgtgtaaccccatcatcagcggactgtaccagggtgccggtggtcccgggcctggg
ggcttcggggctcagggtcccaagggagggtctgggtcaggccccaccattgaggaggta
gattag

DBGET integrated database retrieval system