KEGG   Homo sapiens (human): 3309Help
Entry
3309              CDS       T01001                                 

Gene name
HSPA5, BIP, GRP78, HEL-S-89n, MIF2
Definition
(RefSeq) heat shock protein family A (Hsp70) member 5
  KO
K09490  heat shock 70kDa protein 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa03060  Protein export
hsa04141  Protein processing in endoplasmic reticulum
hsa04612  Antigen processing and presentation
hsa04918  Thyroid hormone synthesis
hsa05020  Prion diseases
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    3309 (HSPA5)
   04141 Protein processing in endoplasmic reticulum
    3309 (HSPA5)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    3309 (HSPA5)
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    3309 (HSPA5)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05020 Prion diseases
    3309 (HSPA5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    3309 (HSPA5)
   04131 Membrane trafficking [BR:hsa04131]
    3309 (HSPA5)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3309 (HSPA5)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP70 / DNAK
   3309 (HSPA5)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    3309 (HSPA5)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3309 (HSPA5)
  Exosomal proteins of other body fluids (saliva and urine)
   3309 (HSPA5)
  Exosomal proteins of colorectal cancer cells
   3309 (HSPA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FtsA DUF4624 Hydantoinase_A DDR FGGY_C
Motif
Other DBs
NCBI-GeneID: 3309
NCBI-ProteinID: NP_005338
OMIM: 138120
HGNC: 5238
Ensembl: ENSG00000044574
Vega: OTTHUMG00000020672
Pharos: P11021(Tchem)
UniProt: P11021 V9HWB4
Structure
PDB: 

Position
9q33.3
AA seq 654 aa AA seqDB search
MKLSLVAAMLLLLSAARAEEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNR
ITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVV
EKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQ
RQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNG
VFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALS
SQHQARIEIESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIV
LVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVC
PLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLG
TFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIER
MVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEE
KIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSAGPPPTGEEDTAEKDEL
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctccctggtggccgcgatgctgctgctgctcagcgcggcgcgggccgaggag
gaggacaagaaggaggacgtgggcacggtggtcggcatcgacctggggaccacctactcc
tgcgtcggcgtgttcaagaacggccgcgtggagatcatcgccaacgatcagggcaaccgc
atcacgccgtcctatgtcgccttcactcctgaaggggaacgtctgattggcgatgccgcc
aagaaccagctcacctccaaccccgagaacacggtctttgacgccaagcggctcatcggc
cgcacgtggaatgacccgtctgtgcagcaggacatcaagttcttgccgttcaaggtggtt
gaaaagaaaactaaaccatacattcaagttgatattggaggtgggcaaacaaagacattt
gctcctgaagaaatttctgccatggttctcactaaaatgaaagaaaccgctgaggcttat
ttgggaaagaaggttacccatgcagttgttactgtaccagcctattttaatgatgcccaa
cgccaagcaaccaaagacgctggaactattgctggcctaaatgttatgaggatcatcaac
gagcctacggcagctgctattgcttatggcctggataagagggagggggagaagaacatc
ctggtgtttgacctgggtggcggaaccttcgatgtgtctcttctcaccattgacaatggt
gtcttcgaagttgtggccactaatggagatactcatctgggtggagaagactttgaccag
cgtgtcatggaacacttcatcaaactgtacaaaaagaagacgggcaaagatgtcaggaaa
gacaatagagctgtgcagaaactccggcgcgaggtagaaaaggccaaacgggccctgtct
tctcagcatcaagcaagaattgaaattgagtccttctatgaaggagaagacttttctgag
accctgactcgggccaaatttgaagagctcaacatggatctgttccggtctactatgaag
cccgtccagaaagtgttggaagattctgatttgaagaagtctgatattgatgaaattgtt
cttgttggtggctcgactcgaattccaaagattcagcaactggttaaagagttcttcaat
ggcaaggaaccatcccgtggcataaacccagatgaagctgtagcgtatggtgctgctgtc
caggctggtgtgctctctggtgatcaagatacaggtgacctggtactgcttgatgtatgt
ccccttacacttggtattgaaactgtgggaggtgtcatgaccaaactgattccaaggaac
acagtggtgcctaccaagaagtctcagatcttttctacagcttctgataatcaaccaact
gttacaatcaaggtctatgaaggtgaaagacccctgacaaaagacaatcatcttctgggt
acatttgatctgactggaattcctcctgctcctcgtggggtcccacagattgaagtcacc
tttgagatagatgtgaatggtattcttcgagtgacagctgaagacaagggtacagggaac
aaaaataagatcacaatcaccaatgaccagaatcgcctgacacctgaagaaatcgaaagg
atggttaatgatgctgagaagtttgctgaggaagacaaaaagctcaaggagcgcattgat
actagaaatgagttggaaagctatgcctattctctaaagaatcagattggagataaagaa
aagctgggaggtaaactttcctctgaagataaggagaccatggaaaaagctgtagaagaa
aagattgaatggctggaaagccaccaagatgctgacattgaagacttcaaagctaagaag
aaggaactggaagaaattgttcaaccaattatcagcaaactctatggaagtgcaggccct
cccccaactggtgaagaggatacagcagaaaaagatgagttgtag

DBGET integrated database retrieval system