KEGG   Homo sapiens (human): 331Help
Entry
331               CDS       T01001                                 

Gene name
XIAP, API3, BIRC4, IAP-3, ILP1, MIHA, XLP2, hIAP-3, hIAP3
Definition
(RefSeq) X-linked inhibitor of apoptosis
  KO
K04725  E3 ubiquitin-protein ligase XIAP [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa04064  NF-kappa B signaling pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04217  Necroptosis
hsa04510  Focal adhesion
hsa04621  NOD-like receptor signaling pathway
hsa05145  Toxoplasmosis
hsa05166  HTLV-I infection
hsa05200  Pathways in cancer
hsa05222  Small cell lung cancer
Disease
H00107  Other well-defined immunodeficiency syndromes
H01969  X-linked lymphoproliferative syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    331 (XIAP)
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    331 (XIAP)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    331 (XIAP)
   04215 Apoptosis - multiple species
    331 (XIAP)
   04217 Necroptosis
    331 (XIAP)
  Cellular community - eukaryotes
   04510 Focal adhesion
    331 (XIAP)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    331 (XIAP)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    331 (XIAP)
   05222 Small cell lung cancer
    331 (XIAP)
  Infectious diseases
   05166 HTLV-I infection
    331 (XIAP)
   05145 Toxoplasmosis
    331 (XIAP)
  Drug resistance
   01524 Platinum drug resistance
    331 (XIAP)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     331 (XIAP)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    331 (XIAP)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    331 (XIAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 DUF2039
Motif
Other DBs
NCBI-GeneID: 331
NCBI-ProteinID: NP_001158
OMIM: 300079
HGNC: 592
Ensembl: ENSG00000101966
Vega: OTTHUMG00000022336
Pharos: P98170(Tchem)
UniProt: P98170
Structure
PDB: 

Position
Xq25
AA seq 497 aa AA seqDB search
MTFNSFEGSKTCVPADINKEEEFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDT
VRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYLENSATQSTNSGIQNGQYKVENY
LGSRDHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLT
PRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSE
SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKC
FHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTTEKTP
SLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKD
SMQDESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDK
CPMCYTVITFKQKIFMS
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgacttttaacagttttgaaggatctaaaacttgtgtacctgcagacatcaataaggaa
gaagaatttgtagaagagtttaatagattaaaaacttttgctaattttccaagtggtagt
cctgtttcagcatcaacactggcacgagcagggtttctttatactggtgaaggagatacc
gtgcggtgctttagttgtcatgcagctgtagatagatggcaatatggagactcagcagtt
ggaagacacaggaaagtatccccaaattgcagatttatcaacggcttttatcttgaaaat
agtgccacgcagtctacaaattctggtatccagaatggtcagtacaaagttgaaaactat
ctgggaagcagagatcattttgccttagacaggccatctgagacacatgcagactatctt
ttgagaactgggcaggttgtagatatatcagacaccatatacccgaggaaccctgccatg
tatagtgaagaagctagattaaagtcctttcagaactggccagactatgctcacctaacc
ccaagagagttagcaagtgctggactctactacacaggtattggtgaccaagtgcagtgc
ttttgttgtggtggaaaactgaaaaattgggaaccttgtgatcgtgcctggtcagaacac
aggcgacactttcctaattgcttctttgttttgggccggaatcttaatattcgaagtgaa
tctgatgctgtgagttctgataggaatttcccaaattcaacaaatcttccaagaaatcca
tccatggcagattatgaagcacggatctttacttttgggacatggatatactcagttaac
aaggagcagcttgcaagagctggattttatgctttaggtgaaggtgataaagtaaagtgc
tttcactgtggaggagggctaactgattggaagcccagtgaagacccttgggaacaacat
gctaaatggtatccagggtgcaaatatctgttagaacagaagggacaagaatatataaac
aatattcatttaactcattcacttgaggagtgtctggtaagaactactgagaaaacacca
tcactaactagaagaattgatgataccatcttccaaaatcctatggtacaagaagctata
cgaatggggttcagtttcaaggacattaagaaaataatggaggaaaaaattcagatatct
gggagcaactataaatcacttgaggttctggttgcagatctagtgaatgctcagaaagac
agtatgcaagatgagtcaagtcagacttcattacagaaagagattagtactgaagagcag
ctaaggcgcctgcaagaggagaagctttgcaaaatctgtatggatagaaatattgctatc
gtttttgttccttgtggacatctagtcacttgtaaacaatgtgctgaagcagttgacaag
tgtcccatgtgctacacagtcattactttcaagcaaaaaatttttatgtcttaa

DBGET integrated database retrieval system