KEGG   Homo sapiens (human): 3315Help
Entry
3315              CDS       T01001                                 

Gene name
HSPB1, CMT2F, HEL-S-102, HMN2B, HS.76067, HSP27, HSP28, Hsp25, SRP27
Definition
(RefSeq) heat shock protein family B (small) member 1
  KO
K04455  heat shock protein beta-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04370  VEGF signaling pathway
hsa05146  Amoebiasis
hsa05169  Epstein-Barr virus infection
Disease
H00856  Distal hereditary motor neuropathies
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    3315 (HSPB1)
   04370 VEGF signaling pathway
    3315 (HSPB1)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05169 Epstein-Barr virus infection
    3315 (HSPB1)
  09174 Infectious diseases: Parasitic
   05146 Amoebiasis
    3315 (HSPB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    3315 (HSPB1)
   03110 Chaperones and folding catalysts [BR:hsa03110]
    3315 (HSPB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3315 (HSPB1)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP related factors
    3315 (HSPB1)
 Complex C
   U4/U6.U5 tri-SnRNP related factors
    3315 (HSPB1)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP20
   3315 (HSPB1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   3315 (HSPB1)
  Exosomal proteins of breast cancer cells
   3315 (HSPB1)
  Exosomal proteins of bladder cancer cells
   3315 (HSPB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP20 YabP
Motif
Other DBs
NCBI-GeneID: 3315
NCBI-ProteinID: NP_001531
OMIM: 602195
HGNC: 5246
Ensembl: ENSG00000106211
Vega: OTTHUMG00000023228
Pharos: P04792(Tchem)
UniProt: P04792 V9HW43
Structure
PDB: 

Position
7q11.23
AA seq 205 aa AA seqDB search
MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPP
AAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEI
TGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEIT
IPVTFESRAQLGGPEAAKSDETAAK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcgccgcgtccccttctcgctcctgcggggccccagctgggaccccttccgc
gactggtacccgcatagccgcctcttcgaccaggccttcgggctgccccggctgccggag
gagtggtcgcagtggttaggcggcagcagctggccaggctacgtgcgccccctgcccccc
gccgccatcgagagccccgcagtggccgcgcccgcctacagccgcgcgctcagccggcaa
ctcagcagcggggtctcggagatccggcacactgcggaccgctggcgcgtgtccctggat
gtcaaccacttcgccccggacgagctgacggtcaagaccaaggatggcgtggtggagatc
accggcaagcacgaggagcggcaggacgagcatggctacatctcccggtgcttcacgcgg
aaatacacgctgccccccggtgtggaccccacccaagtttcctcctccctgtcccctgag
ggcacactgaccgtggaggcccccatgcccaagctagccacgcagtccaacgagatcacc
atcccagtcaccttcgagtcgcgggcccagcttgggggcccagaagctgcaaaatccgat
gagactgccgccaagtaa

DBGET integrated database retrieval system